Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-RelB |
| Location | 294627..295140 | Replicon | chromosome |
| Accession | NZ_CP118097 | ||
| Organism | Streptococcus dysgalactiae subsp. equisimilis strain MGCS35922 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | - |
| Locus tag | MGCS35922_RS01630 | Protein ID | WP_084916229.1 |
| Coordinates | 294627..294881 (-) | Length | 85 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | - |
| Locus tag | MGCS35922_RS01635 | Protein ID | WP_003053797.1 |
| Coordinates | 294874..295140 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGCS35922_RS01600 (MGCS35922_00650) | 290869..291279 | - | 411 | WP_003053802.1 | conjugal transfer protein | - |
| MGCS35922_RS01605 (MGCS35922_00652) | 291282..291506 | - | 225 | WP_003053785.1 | hypothetical protein | - |
| MGCS35922_RS01610 (MGCS35922_00654) | 291510..292520 | - | 1011 | WP_022554213.1 | conjugal transfer protein | - |
| MGCS35922_RS01615 (MGCS35922_00656) | 292532..293068 | - | 537 | WP_003053800.1 | hypothetical protein | - |
| MGCS35922_RS01620 (MGCS35922_00658) | 293095..293325 | - | 231 | WP_003053793.1 | hypothetical protein | - |
| MGCS35922_RS01625 (MGCS35922_00660) | 293345..294571 | - | 1227 | WP_084916231.1 | replication initiation factor domain-containing protein | - |
| MGCS35922_RS01630 (MGCS35922_00662) | 294627..294881 | - | 255 | WP_084916229.1 | Txe/YoeB family addiction module toxin | Toxin |
| MGCS35922_RS01635 (MGCS35922_00664) | 294874..295140 | - | 267 | WP_003053797.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| MGCS35922_RS01640 (MGCS35922_00666) | 295405..297090 | - | 1686 | WP_084916228.1 | FtsK/SpoIIIE domain-containing protein | - |
| MGCS35922_RS01645 (MGCS35922_00668) | 297107..297568 | - | 462 | WP_003056467.1 | hypothetical protein | - |
| MGCS35922_RS01650 (MGCS35922_00670) | 297587..297883 | - | 297 | WP_003056470.1 | hypothetical protein | - |
| MGCS35922_RS01655 (MGCS35922_00672) | 297923..298168 | - | 246 | WP_003056472.1 | hypothetical protein | - |
| MGCS35922_RS01660 (MGCS35922_00674) | 298741..299082 | + | 342 | WP_110408064.1 | helix-turn-helix transcriptional regulator | - |
| MGCS35922_RS01665 (MGCS35922_00676) | 299286..299591 | + | 306 | WP_014612001.1 | hypothetical protein | - |
| MGCS35922_RS01670 (MGCS35922_00678) | 299626..299985 | - | 360 | WP_003053656.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 269102..310864 | 41762 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10502.78 Da Isoelectric Point: 8.4060
>T272754 WP_084916229.1 NZ_CP118097:c294881-294627 [Streptococcus dysgalactiae subsp. equisimilis]
MFNFTEEAWEDYTSWQREDKKNLKRINRLIEDIKRHPFEGIGKPEPLKYRYSGAWSRRITDEHRLVYTVEQNDIYFLSFR
DHYK
MFNFTEEAWEDYTSWQREDKKNLKRINRLIEDIKRHPFEGIGKPEPLKYRYSGAWSRRITDEHRLVYTVEQNDIYFLSFR
DHYK
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|