Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-RelB |
| Location | 692728..693242 | Replicon | chromosome |
| Accession | NZ_CP118092 | ||
| Organism | Limosilactobacillus fermentum strain VSI05 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | - |
| Locus tag | PUW73_RS03360 | Protein ID | WP_046949245.1 |
| Coordinates | 692979..693242 (+) | Length | 88 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | C0WV67 |
| Locus tag | PUW73_RS03355 | Protein ID | WP_003684069.1 |
| Coordinates | 692728..692982 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUW73_RS03340 (PUW73_03340) | 688363..689502 | + | 1140 | WP_178958848.1 | IS30 family transposase | - |
| PUW73_RS03345 (PUW73_03345) | 689806..691158 | + | 1353 | WP_274983054.1 | transposase | - |
| PUW73_RS03350 (PUW73_03350) | 691273..692493 | + | 1221 | WP_274982864.1 | IS256 family transposase | - |
| PUW73_RS03355 (PUW73_03355) | 692728..692982 | + | 255 | WP_003684069.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PUW73_RS03360 (PUW73_03360) | 692979..693242 | + | 264 | WP_046949245.1 | Txe/YoeB family addiction module toxin | Toxin |
| PUW73_RS03365 (PUW73_03365) | 693652..694773 | - | 1122 | WP_274983055.1 | PTS sugar transporter subunit IIC | - |
| PUW73_RS03370 (PUW73_03370) | 694937..696391 | - | 1455 | WP_274982839.1 | transposase | - |
| PUW73_RS03375 (PUW73_03375) | 696768..698165 | - | 1398 | WP_024271998.1 | Na+/H+ antiporter NhaC family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10284.99 Da Isoelectric Point: 10.3799
>T272751 WP_046949245.1 NZ_CP118092:692979-693242 [Limosilactobacillus fermentum]
MSYAIKLKRSANKDLKKIKGSYLEKSFLQIIEQLRKDPLAPNQGFEKLVPPIKGFYSRRINIQHRLVYKVDQDTQTVIIY
SAWSHYE
MSYAIKLKRSANKDLKKIKGSYLEKSFLQIIEQLRKDPLAPNQGFEKLVPPIKGFYSRRINIQHRLVYKVDQDTQTVIIY
SAWSHYE
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|