Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-couple_hipB |
Location | 1497297..1497945 | Replicon | chromosome |
Accession | NZ_CP118078 | ||
Organism | Streptococcus anginosus strain VSI16 |
Toxin (Protein)
Gene name | higB | Uniprot ID | F9P6Y3 |
Locus tag | PUW52_RS07420 | Protein ID | WP_006268450.1 |
Coordinates | 1497580..1497945 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PUW52_RS07415 | Protein ID | WP_150890982.1 |
Coordinates | 1497297..1497590 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUW52_RS07395 (PUW52_07395) | 1492464..1493510 | - | 1047 | WP_024052823.1 | D-alanine--D-alanine ligase | - |
PUW52_RS07400 (PUW52_07400) | 1493643..1494239 | - | 597 | WP_003023742.1 | recombination mediator RecR | - |
PUW52_RS07405 (PUW52_07405) | 1494250..1496310 | - | 2061 | WP_180364008.1 | penicillin-binding protein PBP2B | - |
PUW52_RS07410 (PUW52_07410) | 1496660..1497205 | - | 546 | WP_150890984.1 | hypothetical protein | - |
PUW52_RS07415 (PUW52_07415) | 1497297..1497590 | - | 294 | WP_150890982.1 | helix-turn-helix transcriptional regulator | Antitoxin |
PUW52_RS07420 (PUW52_07420) | 1497580..1497945 | - | 366 | WP_006268450.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUW52_RS07425 (PUW52_07425) | 1498011..1498286 | - | 276 | WP_150890980.1 | terminase small subunit | - |
PUW52_RS07430 (PUW52_07430) | 1498366..1498596 | - | 231 | WP_022525741.1 | hypothetical protein | - |
PUW52_RS07435 (PUW52_07435) | 1498828..1499238 | - | 411 | WP_150890979.1 | hypothetical protein | - |
PUW52_RS07440 (PUW52_07440) | 1499231..1499707 | - | 477 | WP_150890977.1 | hypothetical protein | - |
PUW52_RS07445 (PUW52_07445) | 1499754..1500365 | - | 612 | WP_150890975.1 | enoyl-CoA hydratase/isomerase family protein | - |
PUW52_RS07450 (PUW52_07450) | 1500454..1500627 | - | 174 | WP_164232034.1 | hypothetical protein | - |
PUW52_RS07455 (PUW52_07455) | 1500771..1501616 | - | 846 | WP_150890974.1 | ATP-binding protein | - |
PUW52_RS07460 (PUW52_07460) | 1501631..1502437 | - | 807 | WP_150890972.1 | phage replisome organizer N-terminal domain-containing protein | - |
PUW52_RS07465 (PUW52_07465) | 1502446..1502712 | - | 267 | WP_150890970.1 | HTH domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1493643..1510405 | 16762 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 14448.63 Da Isoelectric Point: 9.7920
>T272737 WP_006268450.1 NZ_CP118078:c1497945-1497580 [Streptococcus anginosus]
VHNIYFYKDKNGNEPILDYMRELASKKGKDSRIKLNKINDYIELLSQHGTRTGEPYIKHLDAEIWELRPLRDRILFVAWI
DGSFVLLHHFMKKTQKTPKREIEQAKRELADLKERGLDNEK
VHNIYFYKDKNGNEPILDYMRELASKKGKDSRIKLNKINDYIELLSQHGTRTGEPYIKHLDAEIWELRPLRDRILFVAWI
DGSFVLLHHFMKKTQKTPKREIEQAKRELADLKERGLDNEK
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|