Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) SprA2-sprA1AS/-
Location 2126034..2126182 Replicon chromosome
Accession NZ_CP118060
Organism Staphylococcus haemolyticus strain VSI35

Toxin (Protein)


Gene name SprA2 Uniprot ID -
Locus tag PUW68_RS10515 Protein ID WP_011276560.1
Coordinates 2126034..2126129 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 2126147..2126182 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUW68_RS10480 (PUW68_10480) 2121828..2122244 - 417 WP_011276552.1 DUF1934 family protein -
PUW68_RS10485 (PUW68_10485) 2122533..2122628 + 96 WP_011276553.1 type I toxin-antitoxin system Fst family toxin -
PUW68_RS10490 (PUW68_10490) 2122899..2122995 + 97 Protein_2033 transcriptional regulator -
PUW68_RS10495 (PUW68_10495) 2123142..2123648 + 507 Protein_2034 protein rep -
PUW68_RS10500 (PUW68_10500) 2124551..2124769 + 219 WP_011276556.1 hypothetical protein -
PUW68_RS10505 (PUW68_10505) 2124972..2125167 + 196 Protein_2036 hypothetical protein -
PUW68_RS10510 (PUW68_10510) 2125437..2125685 + 249 WP_033080158.1 hypothetical protein -
PUW68_RS10515 (PUW68_10515) 2126034..2126129 + 96 WP_011276560.1 type I toxin-antitoxin system Fst family toxin Toxin
- 2126147..2126182 + 36 - - Antitoxin
PUW68_RS10520 (PUW68_10520) 2126272..2127041 - 770 Protein_2039 ABC transporter permease -
PUW68_RS10525 (PUW68_10525) 2127043..2127738 - 696 WP_011276562.1 ATP-binding cassette domain-containing protein -
PUW68_RS10530 (PUW68_10530) 2128274..2129740 + 1467 WP_000438873.1 ABC-F type ribosomal protection protein Msr(A) -
PUW68_RS10535 (PUW68_10535) 2129839..2130738 + 900 WP_070678766.1 Mph(C) family macrolide 2'-phosphotransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3670.48 Da        Isoelectric Point: 11.0582

>T272735 WP_011276560.1 NZ_CP118060:2126034-2126129 [Staphylococcus haemolyticus]
MLEIFVHITTTVISGCIIALFTHWLRNRKKK

Download         Length: 96 bp

Antitoxin


Download         Length: 36 bp

>AT272735 NZ_CP118060:2126147-2126182 [Staphylococcus haemolyticus]
TACAAAAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References