Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-RelB |
| Location | 2798107..2798629 | Replicon | chromosome |
| Accession | NZ_CP118050 | ||
| Organism | Lacticaseibacillus rhamnosus strain VSI43 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | C2JUK2 |
| Locus tag | PUW66_RS13035 | Protein ID | WP_005687756.1 |
| Coordinates | 2798369..2798629 (+) | Length | 87 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | C2JUK3 |
| Locus tag | PUW66_RS13030 | Protein ID | WP_005687754.1 |
| Coordinates | 2798107..2798376 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUW66_RS13010 (PUW66_13010) | 2793694..2794263 | - | 570 | WP_005687747.1 | PTS glucitol/sorbitol transporter subunit IIC | - |
| PUW66_RS13015 (PUW66_13015) | 2794276..2794785 | - | 510 | WP_005690780.1 | transcriptional regulator GutM | - |
| PUW66_RS13020 (PUW66_13020) | 2794786..2796654 | - | 1869 | WP_014571687.1 | HTH domain-containing protein | - |
| PUW66_RS13025 (PUW66_13025) | 2796681..2797481 | - | 801 | WP_005690776.1 | SDR family oxidoreductase | - |
| PUW66_RS13030 (PUW66_13030) | 2798107..2798376 | + | 270 | WP_005687754.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| PUW66_RS13035 (PUW66_13035) | 2798369..2798629 | + | 261 | WP_005687756.1 | Txe/YoeB family addiction module toxin | Toxin |
| PUW66_RS13040 (PUW66_13040) | 2798840..2799568 | - | 729 | WP_014571689.1 | L-ribulose-5-phosphate 4-epimerase | - |
| PUW66_RS13045 (PUW66_13045) | 2799765..2800586 | + | 822 | WP_005690770.1 | Cof-type HAD-IIB family hydrolase | - |
| PUW66_RS13050 (PUW66_13050) | 2800653..2801540 | - | 888 | WP_014571690.1 | L-ribulose-5-phosphate 3-epimerase | - |
| PUW66_RS13055 (PUW66_13055) | 2801725..2802504 | - | 780 | WP_005690765.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PUW66_RS13060 (PUW66_13060) | 2802572..2803213 | - | 642 | WP_005690763.1 | 3-keto-L-gulonate-6-phosphate decarboxylase UlaD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 10485.91 Da Isoelectric Point: 9.6577
>T272728 WP_005687756.1 NZ_CP118050:2798369-2798629 [Lacticaseibacillus rhamnosus]
MIKTWTDDAWADYMYWHDQNDKRTIKRINQLIQAIDRDPYKGIGKPEPLRYALTGKWSRRIDQENRIIYSIEKNHINIFA
CRTHYS
MIKTWTDDAWADYMYWHDQNDKRTIKRINQLIQAIDRDPYKGIGKPEPLRYALTGKWSRRIDQENRIIYSIEKNHINIFA
CRTHYS
Download Length: 261 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A249N526 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A249N594 |