Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2520138..2520536 | Replicon | chromosome |
| Accession | NZ_CP118048 | ||
| Organism | Enterococcus faecalis strain VSI48 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | PUW76_RS11985 | Protein ID | WP_023894767.1 |
| Coordinates | 2520138..2520242 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2520394..2520536 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUW76_RS11970 (2515451) | 2515451..2516164 | - | 714 | WP_002354877.1 | trehalose operon repressor | - |
| PUW76_RS11975 (2516425) | 2516425..2519169 | + | 2745 | WP_129226010.1 | glycosyl hydrolase family 65 protein | - |
| PUW76_RS11980 (2519184) | 2519184..2519834 | + | 651 | WP_016614233.1 | beta-phosphoglucomutase | - |
| - (2520018) | 2520018..2520205 | + | 188 | NuclAT_4 | - | - |
| PUW76_RS11985 (2520138) | 2520138..2520242 | - | 105 | WP_023894767.1 | putative holin-like toxin | Toxin |
| - (2520394) | 2520394..2520536 | + | 143 | NuclAT_10 | - | Antitoxin |
| PUW76_RS11990 (2520627) | 2520627..2520749 | - | 123 | WP_002419628.1 | hypothetical protein | - |
| PUW76_RS11995 (2521542) | 2521542..2522513 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
| PUW76_RS12000 (2522688) | 2522688..2523125 | - | 438 | WP_010715474.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
| PUW76_RS12005 (2523258) | 2523258..2523812 | - | 555 | WP_033601100.1 | nucleoside triphosphate pyrophosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3799.63 Da Isoelectric Point: 10.0079
>T272724 WP_023894767.1 NZ_CP118048:c2520242-2520138 [Enterococcus faecalis]
MSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 105 bp
Antitoxin
Download Length: 143 bp
>AT272724 NZ_CP118048:2520394-2520536 [Enterococcus faecalis]
TGTGCTATAATGAAAACGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGCAGAGCCGTTTAAGACGGTGACCGATT
TTGTTACAAAAAATAACCGTACCGATCAAAGTTGACGGTTATTTTTTATTGTCATTTTTAACA
TGTGCTATAATGAAAACGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGCAGAGCCGTTTAAGACGGTGACCGATT
TTGTTACAAAAAATAACCGTACCGATCAAAGTTGACGGTTATTTTTTATTGTCATTTTTAACA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|