Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/- |
| Location | 295801..295995 | Replicon | chromosome |
| Accession | NZ_CP118048 | ||
| Organism | Enterococcus faecalis strain VSI48 | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | PUW76_RS01495 | Protein ID | WP_015543884.1 |
| Coordinates | 295900..295995 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 295801..295865 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUW76_RS01480 (291413) | 291413..293161 | + | 1749 | WP_033601155.1 | PTS transporter subunit EIIC | - |
| PUW76_RS01485 (293152) | 293152..295185 | + | 2034 | WP_033601156.1 | BglG family transcription antiterminator | - |
| PUW76_RS01490 (295196) | 295196..295630 | + | 435 | WP_002355276.1 | PTS sugar transporter subunit IIA | - |
| - (295801) | 295801..295865 | + | 65 | NuclAT_11 | - | Antitoxin |
| PUW76_RS01495 (295900) | 295900..295995 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| PUW76_RS01500 (296241) | 296241..298013 | + | 1773 | WP_033601157.1 | PTS mannitol-specific transporter subunit IIBC | - |
| PUW76_RS01505 (298028) | 298028..298465 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
| PUW76_RS01510 (298480) | 298480..299634 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
| PUW76_RS01515 (299703) | 299703..300818 | - | 1116 | WP_033601158.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T272717 WP_015543884.1 NZ_CP118048:c295995-295900 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT272717 NZ_CP118048:295801-295865 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGCGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGCGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|