Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-couple_hipB |
Location | 1537047..1537695 | Replicon | chromosome |
Accession | NZ_CP118046 | ||
Organism | Streptococcus anginosus strain VSI52 |
Toxin (Protein)
Gene name | higB | Uniprot ID | F9P6Y3 |
Locus tag | PUW62_RS07680 | Protein ID | WP_006268450.1 |
Coordinates | 1537330..1537695 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PUW62_RS07675 | Protein ID | WP_150890982.1 |
Coordinates | 1537047..1537340 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUW62_RS07655 (PUW62_07655) | 1532214..1533260 | - | 1047 | WP_024052823.1 | D-alanine--D-alanine ligase | - |
PUW62_RS07660 (PUW62_07660) | 1533393..1533989 | - | 597 | WP_003023742.1 | recombination mediator RecR | - |
PUW62_RS07665 (PUW62_07665) | 1534000..1536060 | - | 2061 | WP_180364008.1 | penicillin-binding protein PBP2B | - |
PUW62_RS07670 (PUW62_07670) | 1536410..1536955 | - | 546 | WP_150890984.1 | hypothetical protein | - |
PUW62_RS07675 (PUW62_07675) | 1537047..1537340 | - | 294 | WP_150890982.1 | helix-turn-helix transcriptional regulator | Antitoxin |
PUW62_RS07680 (PUW62_07680) | 1537330..1537695 | - | 366 | WP_006268450.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUW62_RS07685 (PUW62_07685) | 1537761..1538036 | - | 276 | WP_150890980.1 | terminase small subunit | - |
PUW62_RS07690 (PUW62_07690) | 1538116..1538346 | - | 231 | WP_022525741.1 | hypothetical protein | - |
PUW62_RS07695 (PUW62_07695) | 1538578..1538988 | - | 411 | WP_150890979.1 | hypothetical protein | - |
PUW62_RS07700 (PUW62_07700) | 1538981..1539457 | - | 477 | WP_150890977.1 | hypothetical protein | - |
PUW62_RS07705 (PUW62_07705) | 1539504..1540115 | - | 612 | WP_150890975.1 | enoyl-CoA hydratase/isomerase family protein | - |
PUW62_RS07710 (PUW62_07710) | 1540204..1540377 | - | 174 | WP_164232034.1 | hypothetical protein | - |
PUW62_RS07715 (PUW62_07715) | 1540521..1541366 | - | 846 | WP_150890974.1 | ATP-binding protein | - |
PUW62_RS07720 (PUW62_07720) | 1541381..1542187 | - | 807 | WP_150890972.1 | phage replisome organizer N-terminal domain-containing protein | - |
PUW62_RS07725 (PUW62_07725) | 1542196..1542462 | - | 267 | WP_150890970.1 | HTH domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1533393..1550155 | 16762 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 14448.63 Da Isoelectric Point: 9.7920
>T272716 WP_006268450.1 NZ_CP118046:c1537695-1537330 [Streptococcus anginosus]
VHNIYFYKDKNGNEPILDYMRELASKKGKDSRIKLNKINDYIELLSQHGTRTGEPYIKHLDAEIWELRPLRDRILFVAWI
DGSFVLLHHFMKKTQKTPKREIEQAKRELADLKERGLDNEK
VHNIYFYKDKNGNEPILDYMRELASKKGKDSRIKLNKINDYIELLSQHGTRTGEPYIKHLDAEIWELRPLRDRILFVAWI
DGSFVLLHHFMKKTQKTPKREIEQAKRELADLKERGLDNEK
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|