Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2383082..2383266 | Replicon | chromosome |
| Accession | NZ_CP118044 | ||
| Organism | Staphylococcus aureus strain VSI56 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | Q2FVI9 |
| Locus tag | PUW46_RS11765 | Protein ID | WP_000482650.1 |
| Coordinates | 2383159..2383266 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2383082..2383142 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUW46_RS11750 (PUW46_11750) | 2378592..2378759 | - | 168 | WP_001792506.1 | hypothetical protein | - |
| PUW46_RS11755 (PUW46_11755) | 2378990..2380723 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein | - |
| PUW46_RS11760 (PUW46_11760) | 2380748..2382511 | - | 1764 | WP_001064820.1 | ABC transporter ATP-binding protein | - |
| - | 2383082..2383142 | + | 61 | - | - | Antitoxin |
| PUW46_RS11765 (PUW46_11765) | 2383159..2383266 | - | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| PUW46_RS11770 (PUW46_11770) | 2383400..2383786 | - | 387 | WP_000779358.1 | flippase GtxA | - |
| PUW46_RS11775 (PUW46_11775) | 2384044..2385186 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
| PUW46_RS11780 (PUW46_11780) | 2385246..2385905 | + | 660 | WP_000831298.1 | membrane protein | - |
| PUW46_RS11785 (PUW46_11785) | 2386087..2387298 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
| PUW46_RS11790 (PUW46_11790) | 2387421..2387894 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | sbi / hlgA / hlgC / hlgB | 2366392..2383786 | 17394 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T272713 WP_000482650.1 NZ_CP118044:c2383266-2383159 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT272713 NZ_CP118044:2383082-2383142 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|