Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1814755..1814935 Replicon chromosome
Accession NZ_CP118044
Organism Staphylococcus aureus strain VSI56

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag PUW46_RS08665 Protein ID WP_001801861.1
Coordinates 1814755..1814850 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1814878..1814935 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUW46_RS08630 (PUW46_08630) 1809796..1810422 + 627 WP_000669021.1 hypothetical protein -
PUW46_RS08635 (PUW46_08635) 1810463..1810804 + 342 WP_000627547.1 DUF3969 family protein -
PUW46_RS08640 (PUW46_08640) 1810905..1811477 + 573 WP_000414206.1 hypothetical protein -
PUW46_RS08645 (PUW46_08645) 1811675..1812303 - 629 Protein_1699 ImmA/IrrE family metallo-endopeptidase -
PUW46_RS08650 (PUW46_08650) 1812603..1812779 - 177 WP_000375476.1 hypothetical protein -
PUW46_RS08655 (PUW46_08655) 1812790..1813173 - 384 WP_000070811.1 hypothetical protein -
PUW46_RS08660 (PUW46_08660) 1813858..1814304 - 447 WP_000747802.1 DUF1433 domain-containing protein -
PUW46_RS08665 (PUW46_08665) 1814755..1814850 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1814878..1814935 - 58 - - Antitoxin
PUW46_RS08670 (PUW46_08670) 1814973..1815074 + 102 WP_001791232.1 hypothetical protein -
PUW46_RS08675 (PUW46_08675) 1815052..1815234 - 183 Protein_1705 transposase -
PUW46_RS08680 (PUW46_08680) 1815422..1815796 - 375 WP_000695818.1 DUF1433 domain-containing protein -
PUW46_RS08685 (PUW46_08685) 1815818..1816096 - 279 WP_001798632.1 DUF1433 domain-containing protein -
PUW46_RS08690 (PUW46_08690) 1816375..1816818 - 444 WP_000742594.1 DUF1433 domain-containing protein -
PUW46_RS08695 (PUW46_08695) 1817466..1818584 - 1119 WP_000072558.1 restriction endonuclease subunit S -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - lukD / hlgA / selk 1788940..1843830 54890


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T272708 WP_001801861.1 NZ_CP118044:1814755-1814850 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 58 bp

>AT272708 NZ_CP118044:c1814935-1814878 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References