Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1814755..1814935 | Replicon | chromosome |
| Accession | NZ_CP118044 | ||
| Organism | Staphylococcus aureus strain VSI56 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | PUW46_RS08665 | Protein ID | WP_001801861.1 |
| Coordinates | 1814755..1814850 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1814878..1814935 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUW46_RS08630 (PUW46_08630) | 1809796..1810422 | + | 627 | WP_000669021.1 | hypothetical protein | - |
| PUW46_RS08635 (PUW46_08635) | 1810463..1810804 | + | 342 | WP_000627547.1 | DUF3969 family protein | - |
| PUW46_RS08640 (PUW46_08640) | 1810905..1811477 | + | 573 | WP_000414206.1 | hypothetical protein | - |
| PUW46_RS08645 (PUW46_08645) | 1811675..1812303 | - | 629 | Protein_1699 | ImmA/IrrE family metallo-endopeptidase | - |
| PUW46_RS08650 (PUW46_08650) | 1812603..1812779 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| PUW46_RS08655 (PUW46_08655) | 1812790..1813173 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| PUW46_RS08660 (PUW46_08660) | 1813858..1814304 | - | 447 | WP_000747802.1 | DUF1433 domain-containing protein | - |
| PUW46_RS08665 (PUW46_08665) | 1814755..1814850 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1814878..1814935 | - | 58 | - | - | Antitoxin |
| PUW46_RS08670 (PUW46_08670) | 1814973..1815074 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| PUW46_RS08675 (PUW46_08675) | 1815052..1815234 | - | 183 | Protein_1705 | transposase | - |
| PUW46_RS08680 (PUW46_08680) | 1815422..1815796 | - | 375 | WP_000695818.1 | DUF1433 domain-containing protein | - |
| PUW46_RS08685 (PUW46_08685) | 1815818..1816096 | - | 279 | WP_001798632.1 | DUF1433 domain-containing protein | - |
| PUW46_RS08690 (PUW46_08690) | 1816375..1816818 | - | 444 | WP_000742594.1 | DUF1433 domain-containing protein | - |
| PUW46_RS08695 (PUW46_08695) | 1817466..1818584 | - | 1119 | WP_000072558.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA / selk | 1788940..1843830 | 54890 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T272708 WP_001801861.1 NZ_CP118044:1814755-1814850 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT272708 NZ_CP118044:c1814935-1814878 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
