Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 1201992..1202791 | Replicon | chromosome |
| Accession | NZ_CP118014 | ||
| Organism | Escherichia coli strain B-766 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | U9XVR9 |
| Locus tag | PT280_RS05880 | Protein ID | WP_000347267.1 |
| Coordinates | 1201992..1202456 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | PT280_RS05885 | Protein ID | WP_001307405.1 |
| Coordinates | 1202456..1202791 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT280_RS05850 (1196993) | 1196993..1197427 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| PT280_RS05855 (1197445) | 1197445..1198323 | - | 879 | WP_001298758.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| PT280_RS05860 (1198313) | 1198313..1199092 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| PT280_RS05865 (1199103) | 1199103..1199576 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| PT280_RS05870 (1199599) | 1199599..1200879 | - | 1281 | WP_000681921.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| PT280_RS05875 (1201128) | 1201128..1201937 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| PT280_RS05880 (1201992) | 1201992..1202456 | - | 465 | WP_000347267.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| PT280_RS05885 (1202456) | 1202456..1202791 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| PT280_RS05890 (1202940) | 1202940..1204511 | - | 1572 | WP_001273741.1 | galactarate dehydratase | - |
| PT280_RS05895 (1204886) | 1204886..1206220 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| PT280_RS05900 (1206236) | 1206236..1207006 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1201992..1213666 | 11674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17807.17 Da Isoelectric Point: 9.4947
>T272674 WP_000347267.1 NZ_CP118014:c1202456-1201992 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XTR4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |