Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 386067..386669 | Replicon | chromosome |
Accession | NZ_CP118014 | ||
Organism | Escherichia coli strain B-766 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | PT280_RS01895 | Protein ID | WP_000897305.1 |
Coordinates | 386358..386669 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PT280_RS01890 | Protein ID | WP_000356397.1 |
Coordinates | 386067..386357 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT280_RS01865 (381993) | 381993..382895 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
PT280_RS01870 (382892) | 382892..383527 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
PT280_RS01875 (383524) | 383524..384453 | + | 930 | WP_000027702.1 | formate dehydrogenase accessory protein FdhE | - |
PT280_RS01880 (384783) | 384783..385025 | - | 243 | WP_001086388.1 | protein YiiF | - |
PT280_RS01885 (385244) | 385244..385462 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
PT280_RS01890 (386067) | 386067..386357 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
PT280_RS01895 (386358) | 386358..386669 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
PT280_RS01900 (386898) | 386898..387806 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
PT280_RS01905 (387870) | 387870..388811 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
PT280_RS01910 (388856) | 388856..389293 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
PT280_RS01915 (389290) | 389290..390162 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
PT280_RS01920 (390156) | 390156..390755 | - | 600 | WP_001315111.1 | glucose-1-phosphatase | - |
PT280_RS01925 (390854) | 390854..391639 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T272670 WP_000897305.1 NZ_CP118014:c386669-386358 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|