Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 941253..941928 | Replicon | chromosome |
| Accession | NZ_CP117993 | ||
| Organism | Enterobacter hormaechei isolate 1023017620-1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PUO93_RS05315 | Protein ID | WP_048246973.1 |
| Coordinates | 941629..941928 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A2J0PXC9 |
| Locus tag | PUO93_RS05310 | Protein ID | WP_015571639.1 |
| Coordinates | 941253..941618 (-) | Length | 122 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUO93_RS05290 | 937709..938443 | + | 735 | WP_048246966.1 | methyltransferase domain-containing protein | - |
| PUO93_RS05295 | 938437..939039 | - | 603 | WP_045906890.1 | short chain dehydrogenase | - |
| PUO93_RS05300 | 939137..940024 | + | 888 | WP_033487545.1 | LysR family transcriptional regulator | - |
| PUO93_RS05305 | 940045..941226 | + | 1182 | WP_015571640.1 | PLP-dependent aminotransferase family protein | - |
| PUO93_RS05310 | 941253..941618 | - | 366 | WP_015571639.1 | HigA family addiction module antitoxin | Antitoxin |
| PUO93_RS05315 | 941629..941928 | - | 300 | WP_048246973.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PUO93_RS05320 | 942179..943378 | - | 1200 | WP_017382757.1 | HlyD family efflux transporter periplasmic adaptor subunit | - |
| PUO93_RS05325 | 943359..945551 | - | 2193 | WP_274292343.1 | type I secretion system permease/ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11601.25 Da Isoelectric Point: 9.6774
>T272654 WP_048246973.1 NZ_CP117993:c941928-941629 [Enterobacter hormaechei]
MINHFRDQWLEDFFLYGRSSNVIPLNLETALARKLDIINAAMSHLDLRSPPGNMYEALSPPLKGYSSIRVNRQYRLVFRW
SEGKADDLYLSPNKYTQHK
MINHFRDQWLEDFFLYGRSSNVIPLNLETALARKLDIINAAMSHLDLRSPPGNMYEALSPPLKGYSSIRVNRQYRLVFRW
SEGKADDLYLSPNKYTQHK
Download Length: 300 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13705.73 Da Isoelectric Point: 9.5936
>AT272654 WP_015571639.1 NZ_CP117993:c941618-941253 [Enterobacter hormaechei]
MTLQQALRKPTTPGEVLQYEYLEPLNLKINDLAEMLNVHRNTVSALVNNNRKLTADMAIKLAKAFNTTIEFWLNLQLNVD
IWEAQSNSRTQEELSRIKTVAEVMAKRKSGKPDVTLHGNSA
MTLQQALRKPTTPGEVLQYEYLEPLNLKINDLAEMLNVHRNTVSALVNNNRKLTADMAIKLAKAFNTTIEFWLNLQLNVD
IWEAQSNSRTQEELSRIKTVAEVMAKRKSGKPDVTLHGNSA
Download Length: 366 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|