Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/Tad-HTH_37
Location 728217..728815 Replicon chromosome
Accession NZ_CP117988
Organism Vibrio campbellii strain 20220413_1

Toxin (Protein)


Gene name higB Uniprot ID I1YFL9
Locus tag PUN50_RS03430 Protein ID WP_001896384.1
Coordinates 728492..728815 (-) Length 108 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag PUN50_RS03425 Protein ID WP_000058216.1
Coordinates 728217..728495 (-) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUN50_RS03410 (PUN50_03410) 725179..726999 + 1821 WP_008844777.1 conjugative transfer system coupling protein TraD -
PUN50_RS03415 (PUN50_03415) 727009..727569 + 561 WP_149151580.1 conjugative transfer protein -
PUN50_RS03420 (PUN50_03420) 727556..728191 + 636 WP_274290869.1 DUF4400 domain-containing protein -
PUN50_RS03425 (PUN50_03425) 728217..728495 - 279 WP_000058216.1 helix-turn-helix transcriptional regulator Antitoxin
PUN50_RS03430 (PUN50_03430) 728492..728815 - 324 WP_001896384.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PUN50_RS03435 (PUN50_03435) 728996..729277 + 282 WP_000433891.1 type IV conjugative transfer system protein TraL -
PUN50_RS03440 (PUN50_03440) 729274..729900 + 627 WP_274290870.1 TraE/TraK family type IV conjugative transfer system protein -
PUN50_RS03445 (PUN50_03445) 729884..730780 + 897 WP_274291235.1 type-F conjugative transfer system secretin TraK -
PUN50_RS03450 (PUN50_03450) 730783..732072 + 1290 WP_274290871.1 TraB/VirB10 family protein -
PUN50_RS03455 (PUN50_03455) 732147..732719 + 573 WP_024008834.1 type IV conjugative transfer system lipoprotein TraV -
PUN50_RS03460 (PUN50_03460) 732716..733102 + 387 WP_023584042.1 TraA family conjugative transfer protein -
PUN50_RS03465 (PUN50_03465) 733143..733649 - 507 WP_274290872.1 GNAT family N-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 704190..774713 70523


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(14-102)

Antitoxin

Cro/C1-type helix-turn-helix domain

(31-81)


Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12281.33 Da        Isoelectric Point: 9.7658

>T272644 WP_001896384.1 NZ_CP117988:c728815-728492 [Vibrio campbellii]
MSWKIDFYDGVEDQILDMPPKIQARMIKLLELMEKHGANLGPPHTESMGDGLFEIRAKAQEGIGRGLFCYLKGKHIYVLH
AFVKKSQKTPKNELNLARDRQKEVQKS

Download         Length: 324 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10517.07 Da        Isoelectric Point: 9.9393

>AT272644 WP_000058216.1 NZ_CP117988:c728495-728217 [Vibrio campbellii]
MSLQKLKQRALANAEVKNEYDKLESEFSFIDQLLTMRTKAGLTQEQVAERMHTQKSNVSRLEKGNANPSWSTLLKYAHAC
GFELTLKPQKMS

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A244CN87

Antitoxin

Source ID Structure

References