Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
Location | 2509518..2509715 | Replicon | chromosome |
Accession | NZ_CP117979 | ||
Organism | Staphylococcus aureus strain B-41012 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | PT798_RS12250 | Protein ID | WP_001802298.1 |
Coordinates | 2509611..2509715 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2509518..2509556 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT798_RS12225 | 2505693..2506358 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
PT798_RS12230 | 2506510..2506830 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
PT798_RS12235 | 2506832..2507812 | + | 981 | WP_000019743.1 | CDF family zinc efflux transporter CzrB | - |
PT798_RS12240 | 2508078..2509169 | + | 1092 | WP_000495681.1 | hypothetical protein | - |
PT798_RS12245 | 2509498..2509572 | + | 75 | Protein_2376 | hypothetical protein | - |
- | 2509518..2509556 | + | 39 | - | - | Antitoxin |
PT798_RS12250 | 2509611..2509715 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
PT798_RS12255 | 2510395..2510553 | + | 159 | WP_001792784.1 | hypothetical protein | - |
PT798_RS12260 | 2511211..2512068 | - | 858 | WP_000370930.1 | HAD family hydrolase | - |
PT798_RS12265 | 2512136..2512918 | - | 783 | WP_000908180.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T272643 WP_001802298.1 NZ_CP117979:c2509715-2509611 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 39 bp
>AT272643 NZ_CP117979:2509518-2509556 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|