Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 2229299..2229479 | Replicon | chromosome |
Accession | NZ_CP117979 | ||
Organism | Staphylococcus aureus strain B-41012 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | PT798_RS10665 | Protein ID | WP_001801861.1 |
Coordinates | 2229299..2229394 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2229422..2229479 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT798_RS10635 | 2225354..2225980 | + | 627 | WP_000669028.1 | hypothetical protein | - |
PT798_RS10640 | 2226067..2226750 | + | 684 | WP_000957233.1 | exotoxin beta-grasp domain-containing protein | - |
PT798_RS10645 | 2226777..2227529 | + | 753 | WP_000764922.1 | staphylococcal enterotoxin type 27 | - |
PT798_RS10650 | 2227661..2228287 | - | 627 | Protein_2100 | ImmA/IrrE family metallo-endopeptidase | - |
PT798_RS10655 | 2228401..2228847 | - | 447 | WP_000747805.1 | DUF1433 domain-containing protein | - |
PT798_RS10660 | 2229023..2229154 | - | 132 | WP_001808010.1 | hypothetical protein | - |
PT798_RS10665 | 2229299..2229394 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 2229422..2229479 | - | 58 | - | - | Antitoxin |
PT798_RS10670 | 2229517..2229615 | + | 99 | Protein_2104 | hypothetical protein | - |
PT798_RS10675 | 2230045..2231169 | - | 1125 | WP_223876714.1 | hypothetical protein | - |
PT798_RS10680 | 2231231..2231740 | - | 510 | WP_223289274.1 | hypothetical protein | - |
PT798_RS10685 | 2231718..2232571 | - | 854 | Protein_2107 | DNA adenine methylase | - |
PT798_RS10690 | 2232610..2233875 | - | 1266 | WP_000072555.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | selk | 2222796..2250762 | 27966 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T272639 WP_001801861.1 NZ_CP117979:2229299-2229394 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT272639 NZ_CP117979:c2229479-2229422 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|