Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/Tad-HTH_37
Location 2509258..2509786 Replicon chromosome
Accession NZ_CP117976
Organism Salmonella enterica strain B-4212

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag PT747_RS11990 Protein ID WP_108429764.1
Coordinates 2509556..2509786 (-) Length 77 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag PT747_RS11985 Protein ID WP_000147078.1
Coordinates 2509258..2509566 (-) Length 103 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PT747_RS11940 (2504383) 2504383..2504628 - 246 WP_000939947.1 excisionase -
PT747_RS11945 (2504697) 2504697..2504855 - 159 WP_000008355.1 hypothetical protein -
PT747_RS11950 (2504992) 2504992..2505819 - 828 WP_023234876.1 DUF2303 family protein -
PT747_RS11955 (2505877) 2505877..2506233 - 357 WP_001539742.1 hypothetical protein -
PT747_RS11960 (2506791) 2506791..2506988 + 198 WP_001624554.1 hypothetical protein -
PT747_RS11965 (2507323) 2507323..2508018 - 696 WP_001020640.1 helix-turn-helix transcriptional regulator -
PT747_RS11970 (2508116) 2508116..2508340 + 225 WP_001191666.1 helix-turn-helix transcriptional regulator -
PT747_RS11975 (2508369) 2508369..2508923 + 555 WP_000509731.1 YmfL family putative regulatory protein -
PT747_RS11980 (2509063) 2509063..2509239 + 177 WP_001525520.1 DUF4222 domain-containing protein -
PT747_RS11985 (2509258) 2509258..2509566 - 309 WP_000147078.1 helix-turn-helix transcriptional regulator Antitoxin
PT747_RS11990 (2509556) 2509556..2509786 - 231 WP_108429764.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PT747_RS11995 (2509910) 2509910..2510539 + 630 Protein_2329 Rha family transcriptional regulator -
PT747_RS12000 (2510663) 2510663..2511400 + 738 Protein_2330 Rha family transcriptional regulator -
PT747_RS12005 (2511397) 2511397..2511621 + 225 WP_000620702.1 hypothetical protein -
PT747_RS12010 (2511618) 2511618..2512436 + 819 WP_001539747.1 helix-turn-helix domain-containing protein -
PT747_RS12015 (2512438) 2512438..2512920 + 483 WP_023234881.1 PerC family transcriptional regulator -
PT747_RS12020 (2512920) 2512920..2513573 + 654 WP_001539748.1 phage N-6-adenine-methyltransferase -
PT747_RS12025 (2513570) 2513570..2513959 + 390 WP_001539749.1 RusA family crossover junction endodeoxyribonuclease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2500834..2546879 46045


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(5-70)

Antitoxin

Cro/C1-type helix-turn-helix domain

(44-94)


Sequences

Toxin        


Download         Length: 77 a.a.        Molecular weight: 8640.11 Da        Isoelectric Point: 10.5308

>T272625 WP_108429764.1 NZ_CP117976:c2509786-2509556 [Salmonella enterica]
MKVYGSNLGEPHTSAFGDGLFELRIKGSDGIARVFYCTLAGKRIVMLHSFIKKTQKTPVAERKKAETRMKEVKHDW

Download         Length: 231 bp

Antitoxin


Download         Length: 103 a.a.        Molecular weight: 11110.77 Da        Isoelectric Point: 7.0152

>AT272625 WP_000147078.1 NZ_CP117976:c2509566-2509258 [Salmonella enterica]
MTGKRNAPTITHDEMAAKWMEDPAFKAEYDAIADEFALLDEMLAARKEAGLTQAEVAERMGTKATAITRMESNLAAGVSG
PSFTTLKKFAQATGKKLQIRFV

Download         Length: 309 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References