Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 580496..581098 | Replicon | chromosome |
Accession | NZ_CP117976 | ||
Organism | Salmonella enterica strain B-4212 |
Toxin (Protein)
Gene name | higB | Uniprot ID | C0Q3J8 |
Locus tag | PT747_RS02655 | Protein ID | WP_001159630.1 |
Coordinates | 580496..580807 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PT747_RS02660 | Protein ID | WP_000362050.1 |
Coordinates | 580808..581098 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT747_RS02630 (576464) | 576464..577063 | + | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
PT747_RS02635 (577057) | 577057..577929 | + | 873 | WP_023235429.1 | virulence factor BrkB family protein | - |
PT747_RS02640 (577926) | 577926..578363 | + | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
PT747_RS02645 (578408) | 578408..579349 | + | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
PT747_RS02650 (579363) | 579363..580278 | - | 916 | Protein_511 | alpha/beta hydrolase | - |
PT747_RS02655 (580496) | 580496..580807 | + | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
PT747_RS02660 (580808) | 580808..581098 | + | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
PT747_RS02665 (581145) | 581145..582074 | - | 930 | WP_001541226.1 | formate dehydrogenase accessory protein FdhE | - |
PT747_RS02670 (582071) | 582071..582706 | - | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
PT747_RS02675 (582703) | 582703..583605 | - | 903 | WP_001541228.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12326.27 Da Isoelectric Point: 9.4460
>T272620 WP_001159630.1 NZ_CP117976:580496-580807 [Salmonella enterica]
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|