Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 6576270..6576865 | Replicon | chromosome |
Accession | NZ_CP117974 | ||
Organism | Pseudomonas aeruginosa strain B-3509 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PT746_RS31080 | Protein ID | WP_071534808.1 |
Coordinates | 6576270..6576548 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PT746_RS31085 | Protein ID | WP_004352673.1 |
Coordinates | 6576560..6576865 (+) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT746_RS31060 | 6571696..6572934 | + | 1239 | WP_003113524.1 | dipeptidase | - |
PT746_RS31065 | 6572996..6573643 | + | 648 | WP_003095021.1 | carbonate dehydratase | - |
PT746_RS31070 | 6573713..6575941 | - | 2229 | WP_004352671.1 | TonB-dependent receptor | - |
PT746_RS31075 | 6576089..6576217 | + | 129 | Protein_6136 | integrase | - |
PT746_RS31080 | 6576270..6576548 | + | 279 | WP_071534808.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PT746_RS31085 | 6576560..6576865 | + | 306 | WP_004352673.1 | HigA family addiction module antitoxin | Antitoxin |
PT746_RS31090 | 6577372..6578259 | + | 888 | WP_124989691.1 | sce7726 family protein | - |
PT746_RS31095 | 6578220..6579134 | + | 915 | WP_124989690.1 | sce7725 family protein | - |
PT746_RS31100 | 6579177..6579512 | - | 336 | WP_029528819.1 | hypothetical protein | - |
PT746_RS31105 | 6579959..6580231 | + | 273 | WP_003115921.1 | hypothetical protein | - |
PT746_RS31110 | 6580443..6580733 | + | 291 | WP_049295997.1 | DUF5447 family protein | - |
PT746_RS31115 | 6581271..6581705 | + | 435 | WP_003140508.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10671.25 Da Isoelectric Point: 8.5576
>T272615 WP_071534808.1 NZ_CP117974:6576270-6576548 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHGIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHGIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|