Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 4116746..4117440 Replicon chromosome
Accession NZ_CP117971
Organism Escherichia coli strain B-1109

Toxin (Protein)


Gene name yafO Uniprot ID Q47157
Locus tag PT723_RS20305 Protein ID WP_001263489.1
Coordinates 4116746..4117144 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1QAE3
Locus tag PT723_RS20310 Protein ID WP_000554758.1
Coordinates 4117147..4117440 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (4112334) 4112334..4112414 - 81 NuclAT_10 - -
- (4112334) 4112334..4112414 - 81 NuclAT_10 - -
- (4112334) 4112334..4112414 - 81 NuclAT_10 - -
- (4112334) 4112334..4112414 - 81 NuclAT_10 - -
PT723_RS20280 (4113010) 4113010..4113468 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
PT723_RS20285 (4113729) 4113729..4115186 + 1458 WP_001292994.1 cytosol nonspecific dipeptidase -
PT723_RS20290 (4115243) 4115243..4115764 - 522 Protein_3955 peptide chain release factor H -
PT723_RS20295 (4115760) 4115760..4115966 - 207 Protein_3956 RtcB family protein -
PT723_RS20300 (4116284) 4116284..4116736 - 453 WP_001059892.1 GNAT family N-acetyltransferase -
PT723_RS20305 (4116746) 4116746..4117144 - 399 WP_001263489.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
PT723_RS20310 (4117147) 4117147..4117440 - 294 WP_000554758.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
PT723_RS20315 (4117492) 4117492..4118547 - 1056 WP_001226164.1 DNA polymerase IV -
PT723_RS20320 (4118618) 4118618..4119403 - 786 WP_000207552.1 putative lateral flagellar export/assembly protein LafU -
PT723_RS20325 (4119375) 4119375..4121087 + 1713 Protein_3962 flagellar biosynthesis protein FlhA -
PT723_RS20330 (4121311) 4121311..4121808 - 498 WP_000006255.1 REP-associated tyrosine transposase RayT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - gmhA/lpcA / tssA / hcp1/tssD1 4116746..4142719 25973


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15487.84 Da        Isoelectric Point: 7.4215

>T272605 WP_001263489.1 NZ_CP117971:c4117144-4116746 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.76 Da        Isoelectric Point: 5.2170

>AT272605 WP_000554758.1 NZ_CP117971:c4117440-4117147 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A090J8B1

Antitoxin

Source ID Structure
AlphaFold DB S1QAE3

References