Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 1061693..1062386 | Replicon | chromosome |
| Accession | NZ_CP117971 | ||
| Organism | Escherichia coli strain B-1109 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | S1EZG2 |
| Locus tag | PT723_RS05130 | Protein ID | WP_000415584.1 |
| Coordinates | 1061693..1061989 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | PT723_RS05135 | Protein ID | WP_000650107.1 |
| Coordinates | 1061991..1062386 (+) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT723_RS05095 (1056782) | 1056782..1057096 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
| PT723_RS05100 (1057127) | 1057127..1057708 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
| PT723_RS05105 (1058027) | 1058027..1058359 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
| PT723_RS05110 (1058405) | 1058405..1059754 | - | 1350 | WP_139935936.1 | quorum sensing histidine kinase QseC | - |
| PT723_RS05115 (1059751) | 1059751..1060410 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
| PT723_RS05120 (1060562) | 1060562..1060954 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| PT723_RS05125 (1061006) | 1061006..1061488 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
| PT723_RS05130 (1061693) | 1061693..1061989 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| PT723_RS05135 (1061991) | 1061991..1062386 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| PT723_RS05140 (1062519) | 1062519..1064126 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
| PT723_RS05145 (1064264) | 1064264..1066522 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T272592 WP_000415584.1 NZ_CP117971:1061693-1061989 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT272592 WP_000650107.1 NZ_CP117971:1061991-1062386 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|