Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 997119..997846 | Replicon | chromosome |
Accession | NZ_CP117971 | ||
Organism | Escherichia coli strain B-1109 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | PT723_RS04825 | Protein ID | WP_000550189.1 |
Coordinates | 997119..997433 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PT723_RS04830 | Protein ID | WP_000560266.1 |
Coordinates | 997430..997846 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT723_RS04805 (993286) | 993286..994272 | - | 987 | WP_001301393.1 | Gfo/Idh/MocA family oxidoreductase | - |
PT723_RS04810 (994351) | 994351..995034 | - | 684 | WP_001183046.1 | vancomycin high temperature exclusion protein | - |
PT723_RS04815 (995111) | 995111..995614 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
PT723_RS04820 (995699) | 995699..996835 | + | 1137 | WP_000018695.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
PT723_RS04825 (997119) | 997119..997433 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
PT723_RS04830 (997430) | 997430..997846 | + | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
PT723_RS04835 (997891) | 997891..999909 | - | 2019 | WP_137044542.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
PT723_RS04840 (1000335) | 1000335..1002686 | - | 2352 | WP_137044544.1 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T272591 WP_000550189.1 NZ_CP117971:997119-997433 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT272591 WP_000560266.1 NZ_CP117971:997430-997846 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|