Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/- |
| Location | 2644170..2644364 | Replicon | chromosome |
| Accession | NZ_CP117970 | ||
| Organism | Enterococcus faecalis strain B-537 | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | PT722_RS12730 | Protein ID | WP_015543884.1 |
| Coordinates | 2644170..2644265 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 2644300..2644364 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT722_RS12710 (2639347) | 2639347..2640462 | + | 1116 | WP_002364956.1 | FAD-dependent oxidoreductase | - |
| PT722_RS12715 (2640531) | 2640531..2641685 | - | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
| PT722_RS12720 (2641700) | 2641700..2642137 | - | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
| PT722_RS12725 (2642152) | 2642152..2643924 | - | 1773 | WP_002391520.1 | PTS mannitol-specific transporter subunit IIBC | - |
| PT722_RS12730 (2644170) | 2644170..2644265 | + | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - (2644300) | 2644300..2644364 | - | 65 | NuclAT_8 | - | Antitoxin |
| PT722_RS12735 (2644535) | 2644535..2644969 | - | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
| PT722_RS12740 (2644980) | 2644980..2647013 | - | 2034 | WP_002355275.1 | BglG family transcription antiterminator | - |
| PT722_RS12745 (2647004) | 2647004..2648746 | - | 1743 | WP_002391519.1 | PTS transporter subunit EIIC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T272587 WP_015543884.1 NZ_CP117970:2644170-2644265 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT272587 NZ_CP117970:c2644364-2644300 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|