Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 2989672..2990365 | Replicon | chromosome |
Accession | NZ_CP117962 | ||
Organism | Escherichia coli strain JM109 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | PT299_RS15730 | Protein ID | WP_000415584.1 |
Coordinates | 2989672..2989968 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | PT299_RS15735 | Protein ID | WP_000650107.1 |
Coordinates | 2989970..2990365 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT299_RS15695 (2984760) | 2984760..2985074 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
PT299_RS15700 (2985105) | 2985105..2985686 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
PT299_RS15705 (2986005) | 2986005..2986337 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
PT299_RS15710 (2986383) | 2986383..2987732 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
PT299_RS15715 (2987729) | 2987729..2988388 | - | 660 | WP_001221495.1 | quorum sensing response regulator transcription factor QseB | - |
PT299_RS15720 (2988540) | 2988540..2988932 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
PT299_RS15725 (2988985) | 2988985..2989467 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
PT299_RS15730 (2989672) | 2989672..2989968 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
PT299_RS15735 (2989970) | 2989970..2990365 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
PT299_RS15740 (2990498) | 2990498..2992105 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
PT299_RS15745 (2992243) | 2992243..2994501 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T272553 WP_000415584.1 NZ_CP117962:2989672-2989968 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT272553 WP_000650107.1 NZ_CP117962:2989970-2990365 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|