Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symE-ohsC/SymE(toxin) |
Location | 1574226..1574638 | Replicon | chromosome |
Accession | NZ_CP117962 | ||
Organism | Escherichia coli strain JM109 |
Toxin (Protein)
Gene name | symE | Uniprot ID | U9YSY7 |
Locus tag | PT299_RS08900 | Protein ID | WP_000132601.1 |
Coordinates | 1574297..1574638 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | ohsC | ||
Locus tag | - | ||
Coordinates | 1574226..1574302 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT299_RS08890 (1571089) | 1571089..1572678 | + | 1590 | WP_001063204.1 | type I restriction-modification system methyltransferase | - |
PT299_RS08895 (1572675) | 1572675..1574069 | + | 1395 | WP_001272447.1 | type I restriction-modification system specificity subunit | - |
- (1574226) | 1574226..1574302 | - | 77 | NuclAT_13 | - | Antitoxin |
- (1574226) | 1574226..1574302 | - | 77 | NuclAT_13 | - | Antitoxin |
- (1574226) | 1574226..1574302 | - | 77 | NuclAT_13 | - | Antitoxin |
- (1574226) | 1574226..1574302 | - | 77 | NuclAT_13 | - | Antitoxin |
- (1574226) | 1574226..1574302 | - | 77 | NuclAT_14 | - | Antitoxin |
- (1574226) | 1574226..1574302 | - | 77 | NuclAT_14 | - | Antitoxin |
- (1574226) | 1574226..1574302 | - | 77 | NuclAT_14 | - | Antitoxin |
- (1574226) | 1574226..1574302 | - | 77 | NuclAT_14 | - | Antitoxin |
PT299_RS08900 (1574297) | 1574297..1574638 | + | 342 | WP_000132601.1 | endoribonuclease SymE | Toxin |
PT299_RS08905 (1574800) | 1574800..1576179 | + | 1380 | WP_000443951.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
PT299_RS08910 (1576179) | 1576179..1577225 | + | 1047 | WP_000437621.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12203.02 Da Isoelectric Point: 8.5012
>T272546 WP_000132601.1 NZ_CP117962:1574297-1574638 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT272546 NZ_CP117962:c1574302-1574226 [Escherichia coli]
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|