Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 125646..126067 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP117961 | ||
| Organism | Escherichia coli strain JM109 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | PT299_RS00670 | Protein ID | WP_096937776.1 |
| Coordinates | 125942..126067 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 125646..125844 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT299_RS00640 (121576) | 121576..122115 | + | 540 | WP_000290801.1 | single-stranded DNA-binding protein | - |
| PT299_RS00645 (122172) | 122172..122405 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
| PT299_RS00650 (122471) | 122471..124429 | + | 1959 | WP_000117173.1 | ParB/RepB/Spo0J family partition protein | - |
| PT299_RS00655 (124484) | 124484..124918 | + | 435 | WP_000845928.1 | conjugation system SOS inhibitor PsiB | - |
| PT299_RS00660 (124915) | 124915..125677 | + | 763 | Protein_130 | plasmid SOS inhibition protein A | - |
| - (125646) | 125646..125844 | + | 199 | NuclAT_0 | - | Antitoxin |
| - (125646) | 125646..125844 | + | 199 | NuclAT_0 | - | Antitoxin |
| - (125646) | 125646..125844 | + | 199 | NuclAT_0 | - | Antitoxin |
| - (125646) | 125646..125844 | + | 199 | NuclAT_0 | - | Antitoxin |
| PT299_RS00665 (125851) | 125851..126000 | + | 150 | Protein_131 | DUF5431 family protein | - |
| PT299_RS00670 (125942) | 125942..126067 | + | 126 | WP_096937776.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| PT299_RS00675 (126368) | 126368..126664 | - | 297 | Protein_133 | hypothetical protein | - |
| PT299_RS00680 (126734) | 126734..126940 | + | 207 | WP_000547965.1 | hypothetical protein | - |
| PT299_RS00685 (126965) | 126965..127252 | + | 288 | WP_000107542.1 | hypothetical protein | - |
| PT299_RS00690 (127371) | 127371..128192 | + | 822 | WP_001234417.1 | DUF932 domain-containing protein | - |
| PT299_RS00695 (128488) | 128488..129078 | - | 591 | WP_170919186.1 | transglycosylase SLT domain-containing protein | - |
| PT299_RS00700 (129411) | 129411..129794 | + | 384 | WP_001151527.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| PT299_RS00705 (129981) | 129981..130670 | + | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | yagV/ecpE / yagW/ecpD / yagX/ecpC / yagY/ecpB / yagZ/ecpA / ykgK/ecpR / fdeC | 1..231544 | 231544 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4806.72 Da Isoelectric Point: 8.4890
>T272536 WP_096937776.1 NZ_CP117961:125942-126067 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 199 bp
>AT272536 NZ_CP117961:125646-125844 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|