Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 489..1183 | Replicon | plasmid unnamed1 |
Accession | NZ_CP117961 | ||
Organism | Escherichia coli strain JM109 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | PT299_RS00015 | Protein ID | WP_001263489.1 |
Coordinates | 785..1183 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | PT299_RS00010 | Protein ID | WP_000554758.1 |
Coordinates | 489..782 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT299_RS00010 (489) | 489..782 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
PT299_RS00015 (785) | 785..1183 | + | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
PT299_RS00020 (1193) | 1193..1645 | + | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
PT299_RS00025 (1963) | 1963..2169 | + | 207 | Protein_4 | RtcB family protein | - |
PT299_RS00030 (2165) | 2165..2686 | + | 522 | Protein_5 | peptide chain release factor H | - |
PT299_RS00035 (2743) | 2743..4200 | - | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
PT299_RS00040 (4461) | 4461..4919 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
- (5515) | 5515..5595 | + | 81 | NuclAT_1 | - | - |
- (5515) | 5515..5595 | + | 81 | NuclAT_1 | - | - |
- (5515) | 5515..5595 | + | 81 | NuclAT_1 | - | - |
- (5515) | 5515..5595 | + | 81 | NuclAT_1 | - | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | yagV/ecpE / yagW/ecpD / yagX/ecpC / yagY/ecpB / yagZ/ecpA / ykgK/ecpR / fdeC | 1..231544 | 231544 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T272533 WP_001263489.1 NZ_CP117961:785-1183 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |