Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 3391082..3391775 | Replicon | chromosome |
| Accession | NZ_CP117960 | ||
| Organism | Escherichia coli strain B-3008 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | - |
| Locus tag | PT288_RS16460 | Protein ID | WP_000415583.1 |
| Coordinates | 3391082..3391378 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | PT288_RS16465 | Protein ID | WP_000650107.1 |
| Coordinates | 3391380..3391775 (+) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT288_RS16425 (3386170) | 3386170..3386484 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
| PT288_RS16430 (3386515) | 3386515..3387096 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
| PT288_RS16435 (3387415) | 3387415..3387747 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
| PT288_RS16440 (3387793) | 3387793..3389142 | - | 1350 | WP_000673401.1 | quorum sensing histidine kinase QseC | - |
| PT288_RS16445 (3389139) | 3389139..3389798 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
| PT288_RS16450 (3389950) | 3389950..3390342 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| PT288_RS16455 (3390395) | 3390395..3390877 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
| PT288_RS16460 (3391082) | 3391082..3391378 | + | 297 | WP_000415583.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| PT288_RS16465 (3391380) | 3391380..3391775 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| PT288_RS16470 (3391908) | 3391908..3393515 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
| PT288_RS16475 (3393653) | 3393653..3395911 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11216.99 Da Isoelectric Point: 8.9070
>T272526 WP_000415583.1 NZ_CP117960:3391082-3391378 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGLV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGLV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT272526 WP_000650107.1 NZ_CP117960:3391380-3391775 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|