Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 3326513..3327240 | Replicon | chromosome |
Accession | NZ_CP117960 | ||
Organism | Escherichia coli strain B-3008 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1EX98 |
Locus tag | PT288_RS16155 | Protein ID | WP_000550192.1 |
Coordinates | 3326513..3326827 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PT288_RS16160 | Protein ID | WP_000560266.1 |
Coordinates | 3326824..3327240 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT288_RS16135 (3322680) | 3322680..3323666 | - | 987 | WP_000617698.1 | Gfo/Idh/MocA family oxidoreductase | - |
PT288_RS16140 (3323745) | 3323745..3324428 | - | 684 | WP_001183046.1 | vancomycin high temperature exclusion protein | - |
PT288_RS16145 (3324505) | 3324505..3325008 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
PT288_RS16150 (3325093) | 3325093..3326229 | + | 1137 | WP_000018695.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
PT288_RS16155 (3326513) | 3326513..3326827 | + | 315 | WP_000550192.1 | type II toxin-antitoxin system toxin HigB | Toxin |
PT288_RS16160 (3326824) | 3326824..3327240 | + | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
PT288_RS16165 (3327285) | 3327285..3329303 | - | 2019 | WP_000121433.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
PT288_RS16170 (3329729) | 3329729..3332080 | - | 2352 | WP_000695486.1 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12063.08 Da Isoelectric Point: 10.0409
>T272525 WP_000550192.1 NZ_CP117960:3326513-3326827 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTPKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTPKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT272525 WP_000560266.1 NZ_CP117960:3326824-3327240 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|