Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 3277923..3278722 | Replicon | chromosome |
Accession | NZ_CP117960 | ||
Organism | Escherichia coli strain B-3008 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | PT288_RS15910 | Protein ID | WP_000347251.1 |
Coordinates | 3277923..3278387 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | - |
Locus tag | PT288_RS15915 | Protein ID | WP_012304834.1 |
Coordinates | 3278387..3278722 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT288_RS15880 (3272924) | 3272924..3273358 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
PT288_RS15885 (3273376) | 3273376..3274254 | - | 879 | WP_012304833.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
PT288_RS15890 (3274244) | 3274244..3275023 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
PT288_RS15895 (3275034) | 3275034..3275507 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
PT288_RS15900 (3275530) | 3275530..3276810 | - | 1281 | WP_000681905.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
PT288_RS15905 (3277059) | 3277059..3277868 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
PT288_RS15910 (3277923) | 3277923..3278387 | - | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
PT288_RS15915 (3278387) | 3278387..3278722 | - | 336 | WP_012304834.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
PT288_RS15920 (3278871) | 3278871..3280442 | - | 1572 | WP_001273760.1 | galactarate dehydratase | - |
PT288_RS15925 (3280817) | 3280817..3282151 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
PT288_RS15930 (3282167) | 3282167..3282937 | + | 771 | WP_001058236.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T272524 WP_000347251.1 NZ_CP117960:c3278387-3277923 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|