Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symER/SymE(toxin) |
Location | 1990391..1990803 | Replicon | chromosome |
Accession | NZ_CP117960 | ||
Organism | Escherichia coli strain B-3008 |
Toxin (Protein)
Gene name | symE | Uniprot ID | B1IS82 |
Locus tag | PT288_RS09815 | Protein ID | WP_000132625.1 |
Coordinates | 1990462..1990803 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | symR | ||
Locus tag | - | ||
Coordinates | 1990391..1990467 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT288_RS09800 (1986595) | 1986595..1987756 | - | 1162 | Protein_1918 | IS3-like element IS3 family transposase | - |
PT288_RS09805 (1987822) | 1987822..1988484 | + | 663 | Protein_1919 | N-6 DNA methylase | - |
PT288_RS09810 (1988484) | 1988484..1990241 | + | 1758 | WP_000110077.1 | restriction endonuclease subunit S | - |
- (1990391) | 1990391..1990467 | - | 77 | NuclAT_12 | - | Antitoxin |
- (1990391) | 1990391..1990467 | - | 77 | NuclAT_12 | - | Antitoxin |
- (1990391) | 1990391..1990467 | - | 77 | NuclAT_12 | - | Antitoxin |
- (1990391) | 1990391..1990467 | - | 77 | NuclAT_12 | - | Antitoxin |
- (1990391) | 1990391..1990467 | - | 77 | NuclAT_13 | - | Antitoxin |
- (1990391) | 1990391..1990467 | - | 77 | NuclAT_13 | - | Antitoxin |
- (1990391) | 1990391..1990467 | - | 77 | NuclAT_13 | - | Antitoxin |
- (1990391) | 1990391..1990467 | - | 77 | NuclAT_13 | - | Antitoxin |
PT288_RS09815 (1990462) | 1990462..1990803 | + | 342 | WP_000132625.1 | endoribonuclease SymE | Toxin |
PT288_RS09820 (1990850) | 1990850..1992013 | - | 1164 | WP_225402390.1 | DUF1524 domain-containing protein | - |
PT288_RS09825 (1992061) | 1992061..1992943 | - | 883 | Protein_1923 | DUF262 domain-containing protein | - |
PT288_RS09830 (1993086) | 1993086..1993238 | - | 153 | WP_001496262.1 | hypothetical protein | - |
PT288_RS09835 (1993381) | 1993381..1994793 | + | 1413 | WP_000199353.1 | PLP-dependent aminotransferase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12270.10 Da Isoelectric Point: 8.4952
>T272521 WP_000132625.1 NZ_CP117960:1990462-1990803 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVVVKVMEGCIVLTAQPAAAEESE
LMQSLRQVCKLSARKQKQVQDFIGVITGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVVVKVMEGCIVLTAQPAAAEESE
LMQSLRQVCKLSARKQKQVQDFIGVITGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT272521 NZ_CP117960:c1990467-1990391 [Escherichia coli]
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|