Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 5028860..5029554 | Replicon | chromosome |
| Accession | NZ_CP117959 | ||
| Organism | Escherichia coli strain B-2207 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | A0A3P5GWS5 |
| Locus tag | PT284_RS25055 | Protein ID | WP_001263488.1 |
| Coordinates | 5029156..5029554 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | PT284_RS25050 | Protein ID | WP_000554758.1 |
| Coordinates | 5028860..5029153 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT284_RS25030 (5024491) | 5024491..5024989 | + | 499 | Protein_4738 | REP-associated tyrosine transposase RayT | - |
| PT284_RS25035 (5025213) | 5025213..5026925 | - | 1713 | Protein_4739 | flagellar biosynthesis protein FlhA | - |
| PT284_RS25040 (5026897) | 5026897..5027682 | + | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
| PT284_RS25045 (5027753) | 5027753..5028808 | + | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| PT284_RS25050 (5028860) | 5028860..5029153 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| PT284_RS25055 (5029156) | 5029156..5029554 | + | 399 | WP_001263488.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| PT284_RS25060 (5029564) | 5029564..5030016 | + | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
| PT284_RS25065 (5030334) | 5030334..5030540 | + | 207 | Protein_4745 | RtcB family protein | - |
| PT284_RS25070 (5030536) | 5030536..5031057 | + | 522 | Protein_4746 | peptide chain release factor H | - |
| PT284_RS25075 (5031114) | 5031114..5032571 | - | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
| PT284_RS25080 (5032832) | 5032832..5033290 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| - (5033886) | 5033886..5033966 | + | 81 | NuclAT_12 | - | - |
| - (5033886) | 5033886..5033966 | + | 81 | NuclAT_12 | - | - |
| - (5033886) | 5033886..5033966 | + | 81 | NuclAT_12 | - | - |
| - (5033886) | 5033886..5033966 | + | 81 | NuclAT_12 | - | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15559.90 Da Isoelectric Point: 6.9798
>T272513 WP_001263488.1 NZ_CP117959:5029156-5029554 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQEAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQEAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3P5GWS5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1QAE3 |