Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 69536..69767 Replicon plasmid unnamed1
Accession NZ_CP117958
Organism Escherichia coli strain B-2207

Toxin (Protein)


Gene name srnB Uniprot ID A0A762TWR7
Locus tag PT284_RS00400 Protein ID WP_023144756.1
Coordinates 69536..69670 (-) Length 45 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 69716..69767 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PT284_RS00375 (65231) 65231..66577 + 1347 WP_274270680.1 IS4-like element IS4 family transposase -
PT284_RS00380 (66592) 66592..67371 - 780 Protein_75 IS21-like element ISEc12 family transposase -
PT284_RS00385 (67824) 67824..68681 - 858 WP_032265352.1 incFII family plasmid replication initiator RepA -
PT284_RS00390 (68674) 68674..68748 - 75 WP_031943482.1 RepA leader peptide Tap -
PT284_RS00395 (68985) 68985..69239 - 255 WP_102360536.1 replication regulatory protein RepA -
PT284_RS00400 (69536) 69536..69670 - 135 WP_023144756.1 Hok/Gef family protein Toxin
- (69716) 69716..69767 + 52 NuclAT_1 - Antitoxin
- (69716) 69716..69767 + 52 NuclAT_1 - Antitoxin
- (69716) 69716..69767 + 52 NuclAT_1 - Antitoxin
- (69716) 69716..69767 + 52 NuclAT_1 - Antitoxin
PT284_RS00405 (69734) 69734..70020 - 287 Protein_80 DUF2726 domain-containing protein -
PT284_RS00410 (70533) 70533..70745 - 213 WP_013023861.1 hypothetical protein -
PT284_RS00415 (70876) 70876..71437 - 562 Protein_82 fertility inhibition protein FinO -
PT284_RS00420 (71492) 71492..72238 - 747 WP_000205718.1 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iucA / iucB / iucB / iucC / iucD / iutA 1..122293 122293
- inside IScluster/Tn - - 59672..67371 7699


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-44)


Sequences

Toxin        


Download         Length: 45 a.a.        Molecular weight: 4896.90 Da        Isoelectric Point: 7.7209

>T272484 WP_023144756.1 NZ_CP117958:c69670-69536 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Download         Length: 135 bp

Antitoxin


Download         Length: 52 bp

>AT272484 NZ_CP117958:69716-69767 [Escherichia coli]
TCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A762TWR7

Antitoxin

Download structure file

References