Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-RelB |
Location | 1307558..1308072 | Replicon | chromosome |
Accession | NZ_CP117933 | ||
Organism | Limosilactobacillus fermentum strain B-1840 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | C0WV68 |
Locus tag | PTQ87_RS06725 | Protein ID | WP_003684072.1 |
Coordinates | 1307558..1307821 (-) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | C0WV67 |
Locus tag | PTQ87_RS06730 | Protein ID | WP_003684069.1 |
Coordinates | 1307818..1308072 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTQ87_RS06710 | 1303034..1303816 | + | 783 | WP_035431216.1 | arginine deiminase-related protein | - |
PTQ87_RS06715 | 1304204..1305601 | + | 1398 | WP_003684076.1 | Na+/H+ antiporter NhaC family protein | - |
PTQ87_RS06720 | 1306027..1307148 | + | 1122 | WP_080543055.1 | PTS sugar transporter subunit IIC | - |
PTQ87_RS06725 | 1307558..1307821 | - | 264 | WP_003684072.1 | Txe/YoeB family addiction module toxin | Toxin |
PTQ87_RS06730 | 1307818..1308072 | - | 255 | WP_003684069.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PTQ87_RS06735 | 1308242..1308940 | + | 699 | WP_015639439.1 | helix-turn-helix domain-containing protein | - |
PTQ87_RS06740 | 1308877..1309779 | + | 903 | WP_274235353.1 | IS3 family transposase | - |
PTQ87_RS06745 | 1310342..1311694 | - | 1353 | WP_003684067.1 | IS4 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10301.03 Da Isoelectric Point: 10.3799
>T272472 WP_003684072.1 NZ_CP117933:c1307821-1307558 [Limosilactobacillus fermentum]
MSYAIKLKRSANKDLKKIKGSYLEKSFLQIIEQLRKDPLAPNQGFEKLVLPIKGFYSRRINIQHRLVYKVDQDTQTVIIY
SAWSHYE
MSYAIKLKRSANKDLKKIKGSYLEKSFLQIIEQLRKDPLAPNQGFEKLVLPIKGFYSRRINIQHRLVYKVDQDTQTVIIY
SAWSHYE
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | C0WV68 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A806T868 |