Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 4117321..4117973 | Replicon | chromosome |
| Accession | NZ_CP117886 | ||
| Organism | Serratia ureilytica strain KML.E1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PTZ17_RS19595 | Protein ID | WP_274252768.1 |
| Coordinates | 4117321..4117665 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PTZ17_RS19600 | Protein ID | WP_025304078.1 |
| Coordinates | 4117671..4117973 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTZ17_RS19585 (PTZ17_19585) | 4113664..4115922 | - | 2259 | WP_274252766.1 | molybdopterin guanine dinucleotide-containing S/N-oxide reductase | - |
| PTZ17_RS19590 (PTZ17_19590) | 4116143..4117162 | + | 1020 | WP_033644840.1 | HTH-type transcriptional regulator GalR | - |
| PTZ17_RS19595 (PTZ17_19595) | 4117321..4117665 | + | 345 | WP_274252768.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PTZ17_RS19600 (PTZ17_19600) | 4117671..4117973 | + | 303 | WP_025304078.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| PTZ17_RS19605 (PTZ17_19605) | 4118001..4119263 | - | 1263 | WP_033644838.1 | diaminopimelate decarboxylase | - |
| PTZ17_RS19610 (PTZ17_19610) | 4119397..4120320 | + | 924 | WP_042785280.1 | LysR family transcriptional regulator | - |
| PTZ17_RS19615 (PTZ17_19615) | 4120348..4121256 | - | 909 | WP_033644836.1 | LysR family transcriptional regulator | - |
| PTZ17_RS19620 (PTZ17_19620) | 4121365..4122249 | + | 885 | WP_069100465.1 | MBL fold metallo-hydrolase | - |
| PTZ17_RS19625 (PTZ17_19625) | 4122318..4122965 | + | 648 | WP_033644834.1 | DsbA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13338.45 Da Isoelectric Point: 11.2001
>T272467 WP_274252768.1 NZ_CP117886:4117321-4117665 [Serratia ureilytica]
MWQVVTVERFDDWFLALNNAQQTSILAAIFKLQTFGPQLARPHADTLHFSEAARQLKELRVQHRGRPFRVFFAFDPQRQA
VLLCGGDKTGDKRFYQRMLPIAAMKFSHYLATRR
MWQVVTVERFDDWFLALNNAQQTSILAAIFKLQTFGPQLARPHADTLHFSEAARQLKELRVQHRGRPFRVFFAFDPQRQA
VLLCGGDKTGDKRFYQRMLPIAAMKFSHYLATRR
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|