Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 409876..410600 | Replicon | chromosome |
| Accession | NZ_CP117874 | ||
| Organism | Pectobacterium carotovorum subsp. carotovorum strain ZJ-4-2 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7V8TLN0 |
| Locus tag | PSR30_RS01850 | Protein ID | WP_039504225.1 |
| Coordinates | 409876..410187 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PSR30_RS01855 | Protein ID | WP_261846063.1 |
| Coordinates | 410184..410600 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PSR30_RS01830 (PSR30_01830) | 405825..407360 | - | 1536 | WP_039507301.1 | carbohydrate porin | - |
| PSR30_RS01835 (PSR30_01835) | 407560..408483 | - | 924 | WP_226509727.1 | aminoimidazole riboside kinase | - |
| PSR30_RS01840 (PSR30_01840) | 408807..408995 | + | 189 | WP_039470389.1 | hypothetical protein | - |
| PSR30_RS01845 (PSR30_01845) | 409165..409716 | + | 552 | WP_261846062.1 | polymer-forming cytoskeletal protein | - |
| PSR30_RS01850 (PSR30_01850) | 409876..410187 | + | 312 | WP_039504225.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PSR30_RS01855 (PSR30_01855) | 410184..410600 | + | 417 | WP_261846063.1 | helix-turn-helix domain-containing protein | Antitoxin |
| PSR30_RS01860 (PSR30_01860) | 410806..411264 | + | 459 | WP_040031891.1 | hypothetical protein | - |
| PSR30_RS01865 (PSR30_01865) | 411362..412714 | - | 1353 | WP_226294620.1 | pyridoxal-dependent decarboxylase | - |
| PSR30_RS01870 (PSR30_01870) | 412766..414022 | - | 1257 | WP_274214717.1 | MFS transporter | - |
| PSR30_RS01875 (PSR30_01875) | 414176..414622 | + | 447 | WP_274214718.1 | helix-turn-helix domain-containing protein | - |
| PSR30_RS01880 (PSR30_01880) | 414632..415099 | + | 468 | WP_039507317.1 | YhbP family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12406.28 Da Isoelectric Point: 10.0380
>T272439 WP_039504225.1 NZ_CP117874:409876-410187 [Pectobacterium carotovorum subsp. carotovorum]
MHVISRAPFDTATTQFPNQAAALADLYRVIKREMYATPDDMKKRFPSLDRMKYREKWWVIDIGGGHLRVMFFADFERGKI
FIKHITSHAEYDRLTEYYRRNKE
MHVISRAPFDTATTQFPNQAAALADLYRVIKREMYATPDDMKKRFPSLDRMKYREKWWVIDIGGGHLRVMFFADFERGKI
FIKHITSHAEYDRLTEYYRRNKE
Download Length: 312 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15432.68 Da Isoelectric Point: 4.4558
>AT272439 WP_261846063.1 NZ_CP117874:410184-410600 [Pectobacterium carotovorum subsp. carotovorum]
MMYADAIKAANNLTSIVPFLGGSTSRKDYEDALKLTEYLIESEPDSPLIDMLTAKIDKYEDDAPEFAAFNERIKALPAGI
ALLRVLMDQYQLTQSDFEAEIGKKSLVSRILNGERTLTLDHMRALAKRFDIPVSAFVD
MMYADAIKAANNLTSIVPFLGGSTSRKDYEDALKLTEYLIESEPDSPLIDMLTAKIDKYEDDAPEFAAFNERIKALPAGI
ALLRVLMDQYQLTQSDFEAEIGKKSLVSRILNGERTLTLDHMRALAKRFDIPVSAFVD
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|