Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2943923..2944650 | Replicon | chromosome |
Accession | NZ_CP117852 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F28R |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A418Z4H3 |
Locus tag | PTZ66_RS14315 | Protein ID | WP_017441960.1 |
Coordinates | 2944339..2944650 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PTZ66_RS14310 | Protein ID | WP_000561389.1 |
Coordinates | 2943923..2944342 (-) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTZ66_RS14280 (2940743) | 2940743..2941271 | + | 529 | Protein_2773 | transposase | - |
PTZ66_RS14285 (2941417) | 2941417..2941557 | - | 141 | WP_031615664.1 | hypothetical protein | - |
PTZ66_RS14290 (2941723) | 2941723..2941992 | - | 270 | WP_077907250.1 | hypothetical protein | - |
PTZ66_RS14295 (2942363) | 2942363..2942782 | + | 420 | WP_017441959.1 | GNAT family N-acetyltransferase | - |
PTZ66_RS14300 (2943018) | 2943018..2943176 | - | 159 | WP_023165344.1 | lipopolysaccharide 1,2-N-acetylglucosaminetransferase | - |
PTZ66_RS14305 (2943173) | 2943173..2943667 | - | 495 | WP_077907251.1 | glycosyltransferase | - |
PTZ66_RS14310 (2943923) | 2943923..2944342 | - | 420 | WP_000561389.1 | helix-turn-helix domain-containing protein | Antitoxin |
PTZ66_RS14315 (2944339) | 2944339..2944650 | - | 312 | WP_017441960.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
PTZ66_RS14320 (2944829) | 2944829..2945128 | + | 300 | WP_017441961.1 | hypothetical protein | - |
PTZ66_RS14325 (2945427) | 2945427..2946209 | - | 783 | WP_023242818.1 | DUF2971 domain-containing protein | - |
PTZ66_RS14330 (2946572) | 2946572..2946721 | - | 150 | WP_017441963.1 | hypothetical protein | - |
PTZ66_RS14335 (2946876) | 2946876..2947352 | - | 477 | WP_017441964.1 | hypothetical protein | - |
PTZ66_RS14340 (2947680) | 2947680..2948075 | - | 396 | WP_000422887.1 | DUF1398 domain-containing protein | - |
PTZ66_RS14345 (2948756) | 2948756..2949478 | + | 723 | WP_017441965.1 | SPI-1 type III secretion system guanine nucleotide exchange factor SopE2 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2940933..2941271 | 338 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12453.27 Da Isoelectric Point: 10.1599
>T272402 WP_017441960.1 NZ_CP117852:c2944650-2944339 [Salmonella enterica subsp. enterica serovar Mbandaka]
MHVISKEPFDEAARRYPNDSLAIKALYRLVRERDFSSPAELRKVIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFINKRF
YVKHIATHAEYDKLTRYYRENKE
MHVISKEPFDEAARRYPNDSLAIKALYRLVRERDFSSPAELRKVIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFINKRF
YVKHIATHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15301.49 Da Isoelectric Point: 4.6286
>AT272402 WP_000561389.1 NZ_CP117852:c2944342-2943923 [Salmonella enterica subsp. enterica serovar Mbandaka]
MIANTAKAIEATKALVAAVPFLGGSASEKDYRDALALVDYLIENDDENPLIDFLASKIAEYEDNSKQFAEFNKSVAEMPV
GVALLRTLIDQYKLSYSDLKEEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MIANTAKAIEATKALVAAVPFLGGSASEKDYRDALALVDYLIENDDENPLIDFLASKIAEYEDNSKQFAEFNKSVAEMPV
GVALLRTLIDQYKLSYSDLKEEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|