Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-RelB |
| Location | 1298681..1299219 | Replicon | chromosome |
| Accession | NZ_CP117852 | ||
| Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F28R | ||
Toxin (Protein)
| Gene name | yafQ | Uniprot ID | M7RHM1 |
| Locus tag | PTZ66_RS06250 | Protein ID | WP_001526148.1 |
| Coordinates | 1298944..1299219 (+) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | dinJ | Uniprot ID | A0A3V4SM47 |
| Locus tag | PTZ66_RS06245 | Protein ID | WP_017441598.1 |
| Coordinates | 1298681..1298941 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTZ66_RS06230 (1294434) | 1294434..1295987 | + | 1554 | WP_017441601.1 | TROVE domain-containing protein | - |
| PTZ66_RS06235 (1296335) | 1296335..1297549 | + | 1215 | WP_017441600.1 | RNA-splicing ligase RtcB | - |
| PTZ66_RS06240 (1297553) | 1297553..1298572 | + | 1020 | WP_017441599.1 | RNA 3'-terminal phosphate cyclase | - |
| PTZ66_RS06245 (1298681) | 1298681..1298941 | + | 261 | WP_017441598.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PTZ66_RS06250 (1298944) | 1298944..1299219 | + | 276 | WP_001526148.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| PTZ66_RS06255 (1299307) | 1299307..1302012 | - | 2706 | WP_000907030.1 | HTH-type transcriptional regulator MalT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10739.34 Da Isoelectric Point: 8.8652
>T272395 WP_001526148.1 NZ_CP117852:1298944-1299219 [Salmonella enterica subsp. enterica serovar Mbandaka]
MGQREIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIEPDWILIYKITDECLR
FERTGTHADLF
MGQREIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIEPDWILIYKITDECLR
FERTGTHADLF
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3V4SM83 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3V4SM47 |