Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 505442..506196 | Replicon | chromosome |
| Accession | NZ_CP117852 | ||
| Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F28R | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | PTZ66_RS02420 | Protein ID | WP_000558166.1 |
| Coordinates | 505885..506196 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PTZ66_RS02415 | Protein ID | WP_001259011.1 |
| Coordinates | 505442..505888 (-) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTZ66_RS02385 (500618) | 500618..501514 | + | 897 | WP_017441898.1 | sugar kinase | - |
| PTZ66_RS02390 (501548) | 501548..502351 | + | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PTZ66_RS02395 (502542) | 502542..503141 | + | 600 | WP_000965702.1 | glucose-1-phosphatase | - |
| PTZ66_RS02400 (503135) | 503135..504007 | + | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| PTZ66_RS02405 (504004) | 504004..504441 | + | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| PTZ66_RS02410 (504486) | 504486..505427 | + | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PTZ66_RS02415 (505442) | 505442..505888 | - | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PTZ66_RS02420 (505885) | 505885..506196 | - | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PTZ66_RS02425 (506282) | 506282..507211 | - | 930 | WP_017441897.1 | alpha/beta hydrolase | - |
| PTZ66_RS02430 (507429) | 507429..507740 | + | 312 | WP_001159628.1 | hypothetical protein | - |
| PTZ66_RS02435 (507741) | 507741..508031 | + | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| PTZ66_RS02440 (508078) | 508078..509007 | - | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| PTZ66_RS02445 (509004) | 509004..509639 | - | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PTZ66_RS02450 (509636) | 509636..510538 | - | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T272387 WP_000558166.1 NZ_CP117852:c506196-505885 [Salmonella enterica subsp. enterica serovar Mbandaka]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT272387 WP_001259011.1 NZ_CP117852:c505888-505442 [Salmonella enterica subsp. enterica serovar Mbandaka]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|