Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4100417..4101144 | Replicon | chromosome |
| Accession | NZ_CP117851 | ||
| Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_B30R | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A418Z4H3 |
| Locus tag | PTZ67_RS20035 | Protein ID | WP_017441960.1 |
| Coordinates | 4100417..4100728 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PTZ67_RS20040 | Protein ID | WP_000561389.1 |
| Coordinates | 4100725..4101144 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTZ67_RS20005 (4095589) | 4095589..4096311 | - | 723 | WP_017441965.1 | SPI-1 type III secretion system guanine nucleotide exchange factor SopE2 | - |
| PTZ67_RS20010 (4096992) | 4096992..4097387 | + | 396 | WP_000422887.1 | DUF1398 domain-containing protein | - |
| PTZ67_RS20015 (4097715) | 4097715..4098191 | + | 477 | WP_017441964.1 | hypothetical protein | - |
| PTZ67_RS20020 (4098346) | 4098346..4098495 | + | 150 | WP_017441963.1 | hypothetical protein | - |
| PTZ67_RS20025 (4098858) | 4098858..4099640 | + | 783 | WP_023242818.1 | DUF2971 domain-containing protein | - |
| PTZ67_RS20030 (4099939) | 4099939..4100238 | - | 300 | WP_017441961.1 | hypothetical protein | - |
| PTZ67_RS20035 (4100417) | 4100417..4100728 | + | 312 | WP_017441960.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PTZ67_RS20040 (4100725) | 4100725..4101144 | + | 420 | WP_000561389.1 | helix-turn-helix domain-containing protein | Antitoxin |
| PTZ67_RS20045 (4101400) | 4101400..4101894 | + | 495 | WP_077907251.1 | glycosyltransferase | - |
| PTZ67_RS20050 (4101891) | 4101891..4102049 | + | 159 | WP_023165344.1 | lipopolysaccharide 1,2-N-acetylglucosaminetransferase | - |
| PTZ67_RS20055 (4102285) | 4102285..4102704 | - | 420 | WP_017441959.1 | GNAT family N-acetyltransferase | - |
| PTZ67_RS20060 (4103075) | 4103075..4103344 | + | 270 | WP_077907250.1 | hypothetical protein | - |
| PTZ67_RS20065 (4103510) | 4103510..4103650 | + | 141 | WP_031615664.1 | hypothetical protein | - |
| PTZ67_RS20070 (4103796) | 4103796..4104324 | - | 529 | Protein_3911 | transposase | - |
| PTZ67_RS20075 (4104344) | 4104344..4104436 | - | 93 | WP_230855586.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 4103796..4104134 | 338 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12453.27 Da Isoelectric Point: 10.1599
>T272382 WP_017441960.1 NZ_CP117851:4100417-4100728 [Salmonella enterica subsp. enterica serovar Mbandaka]
MHVISKEPFDEAARRYPNDSLAIKALYRLVRERDFSSPAELRKVIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFINKRF
YVKHIATHAEYDKLTRYYRENKE
MHVISKEPFDEAARRYPNDSLAIKALYRLVRERDFSSPAELRKVIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFINKRF
YVKHIATHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15301.49 Da Isoelectric Point: 4.6286
>AT272382 WP_000561389.1 NZ_CP117851:4100725-4101144 [Salmonella enterica subsp. enterica serovar Mbandaka]
MIANTAKAIEATKALVAAVPFLGGSASEKDYRDALALVDYLIENDDENPLIDFLASKIAEYEDNSKQFAEFNKSVAEMPV
GVALLRTLIDQYKLSYSDLKEEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MIANTAKAIEATKALVAAVPFLGGSASEKDYRDALALVDYLIENDDENPLIDFLASKIAEYEDNSKQFAEFNKSVAEMPV
GVALLRTLIDQYKLSYSDLKEEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|