Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1690035..1690789 | Replicon | chromosome |
| Accession | NZ_CP117851 | ||
| Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_B30R | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | PTZ67_RS08300 | Protein ID | WP_000558166.1 |
| Coordinates | 1690035..1690346 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PTZ67_RS08305 | Protein ID | WP_001259011.1 |
| Coordinates | 1690343..1690789 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTZ67_RS08270 (1685693) | 1685693..1686595 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| PTZ67_RS08275 (1686592) | 1686592..1687227 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PTZ67_RS08280 (1687224) | 1687224..1688153 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| PTZ67_RS08285 (1688200) | 1688200..1688490 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| PTZ67_RS08290 (1688491) | 1688491..1688802 | - | 312 | WP_001159628.1 | hypothetical protein | - |
| PTZ67_RS08295 (1689020) | 1689020..1689949 | + | 930 | WP_017441897.1 | alpha/beta hydrolase | - |
| PTZ67_RS08300 (1690035) | 1690035..1690346 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PTZ67_RS08305 (1690343) | 1690343..1690789 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PTZ67_RS08310 (1690804) | 1690804..1691745 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PTZ67_RS08315 (1691790) | 1691790..1692227 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| PTZ67_RS08320 (1692224) | 1692224..1693096 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| PTZ67_RS08325 (1693090) | 1693090..1693689 | - | 600 | WP_000965702.1 | glucose-1-phosphatase | - |
| PTZ67_RS08330 (1693880) | 1693880..1694683 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PTZ67_RS08335 (1694717) | 1694717..1695613 | - | 897 | WP_017441898.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T272373 WP_000558166.1 NZ_CP117851:1690035-1690346 [Salmonella enterica subsp. enterica serovar Mbandaka]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT272373 WP_001259011.1 NZ_CP117851:1690343-1690789 [Salmonella enterica subsp. enterica serovar Mbandaka]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|