Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-RelB |
Location | 897010..897548 | Replicon | chromosome |
Accession | NZ_CP117851 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_B30R |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | M7RHM1 |
Locus tag | PTZ67_RS04465 | Protein ID | WP_001526148.1 |
Coordinates | 897010..897285 (-) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | A0A3V4SM47 |
Locus tag | PTZ67_RS04470 | Protein ID | WP_017441598.1 |
Coordinates | 897288..897548 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTZ67_RS04460 (894217) | 894217..896922 | + | 2706 | WP_000907030.1 | HTH-type transcriptional regulator MalT | - |
PTZ67_RS04465 (897010) | 897010..897285 | - | 276 | WP_001526148.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
PTZ67_RS04470 (897288) | 897288..897548 | - | 261 | WP_017441598.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PTZ67_RS04475 (897657) | 897657..898676 | - | 1020 | WP_017441599.1 | RNA 3'-terminal phosphate cyclase | - |
PTZ67_RS04480 (898680) | 898680..899894 | - | 1215 | WP_017441600.1 | RNA-splicing ligase RtcB | - |
PTZ67_RS04485 (900242) | 900242..901795 | - | 1554 | WP_017441601.1 | TROVE domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10739.34 Da Isoelectric Point: 8.8652
>T272365 WP_001526148.1 NZ_CP117851:c897285-897010 [Salmonella enterica subsp. enterica serovar Mbandaka]
MGQREIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIEPDWILIYKITDECLR
FERTGTHADLF
MGQREIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIEPDWILIYKITDECLR
FERTGTHADLF
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V4SM83 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V4SM47 |