Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-RelB |
| Location | 1365587..1366125 | Replicon | chromosome |
| Accession | NZ_CP117850 | ||
| Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F22R | ||
Toxin (Protein)
| Gene name | yafQ | Uniprot ID | M7RHM1 |
| Locus tag | PTZ65_RS06655 | Protein ID | WP_001526148.1 |
| Coordinates | 1365850..1366125 (+) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | dinJ | Uniprot ID | A0A3V4SM47 |
| Locus tag | PTZ65_RS06650 | Protein ID | WP_017441598.1 |
| Coordinates | 1365587..1365847 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTZ65_RS06635 (1361340) | 1361340..1362893 | + | 1554 | WP_017441601.1 | TROVE domain-containing protein | - |
| PTZ65_RS06640 (1363241) | 1363241..1364455 | + | 1215 | WP_017441600.1 | RNA-splicing ligase RtcB | - |
| PTZ65_RS06645 (1364459) | 1364459..1365478 | + | 1020 | WP_017441599.1 | RNA 3'-terminal phosphate cyclase | - |
| PTZ65_RS06650 (1365587) | 1365587..1365847 | + | 261 | WP_017441598.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PTZ65_RS06655 (1365850) | 1365850..1366125 | + | 276 | WP_001526148.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| PTZ65_RS06660 (1366213) | 1366213..1368918 | - | 2706 | WP_000907030.1 | HTH-type transcriptional regulator MalT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10739.34 Da Isoelectric Point: 8.8652
>T272347 WP_001526148.1 NZ_CP117850:1365850-1366125 [Salmonella enterica subsp. enterica serovar Mbandaka]
MGQREIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIEPDWILIYKITDECLR
FERTGTHADLF
MGQREIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIEPDWILIYKITDECLR
FERTGTHADLF
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3V4SM83 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3V4SM47 |