Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 826438..827192 | Replicon | chromosome |
| Accession | NZ_CP117850 | ||
| Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F22R | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | PTZ65_RS04115 | Protein ID | WP_000558166.1 |
| Coordinates | 826438..826749 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PTZ65_RS04120 | Protein ID | WP_001259011.1 |
| Coordinates | 826746..827192 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTZ65_RS04085 (822096) | 822096..822998 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| PTZ65_RS04090 (822995) | 822995..823630 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PTZ65_RS04095 (823627) | 823627..824556 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| PTZ65_RS04100 (824603) | 824603..824893 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| PTZ65_RS04105 (824894) | 824894..825205 | - | 312 | WP_001159628.1 | hypothetical protein | - |
| PTZ65_RS04110 (825423) | 825423..826352 | + | 930 | WP_017441897.1 | alpha/beta hydrolase | - |
| PTZ65_RS04115 (826438) | 826438..826749 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PTZ65_RS04120 (826746) | 826746..827192 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PTZ65_RS04125 (827207) | 827207..828148 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PTZ65_RS04130 (828193) | 828193..828630 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| PTZ65_RS04135 (828627) | 828627..829499 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| PTZ65_RS04140 (829493) | 829493..830092 | - | 600 | WP_000965702.1 | glucose-1-phosphatase | - |
| PTZ65_RS04145 (830283) | 830283..831086 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PTZ65_RS04150 (831120) | 831120..832016 | - | 897 | WP_017441898.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T272344 WP_000558166.1 NZ_CP117850:826438-826749 [Salmonella enterica subsp. enterica serovar Mbandaka]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT272344 WP_001259011.1 NZ_CP117850:826746-827192 [Salmonella enterica subsp. enterica serovar Mbandaka]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|