Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3592173..3592830 | Replicon | chromosome |
| Accession | NZ_CP117838 | ||
| Organism | Enterobacter sp. S-33 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PUP35_RS16915 | Protein ID | WP_111965881.1 |
| Coordinates | 3592173..3592472 (+) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A1Z3MZ32 |
| Locus tag | PUP35_RS16920 | Protein ID | WP_063408808.1 |
| Coordinates | 3592483..3592830 (+) | Length | 116 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP35_RS16905 | 3588544..3590742 | + | 2199 | WP_274240648.1 | type I secretion system permease/ATPase | - |
| PUP35_RS16910 | 3590753..3591922 | + | 1170 | WP_086374946.1 | HlyD family efflux transporter periplasmic adaptor subunit | - |
| PUP35_RS16915 | 3592173..3592472 | + | 300 | WP_111965881.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PUP35_RS16920 | 3592483..3592830 | + | 348 | WP_063408808.1 | HigA family addiction module antitoxin | Antitoxin |
| PUP35_RS16925 | 3592851..3593369 | - | 519 | WP_133295004.1 | hypothetical protein | - |
| PUP35_RS16930 | 3593455..3594636 | - | 1182 | WP_274240649.1 | PLP-dependent aminotransferase family protein | - |
| PUP35_RS16935 | 3594657..3595544 | - | 888 | WP_115876110.1 | LysR family transcriptional regulator | - |
| PUP35_RS16940 | 3595642..3596244 | + | 603 | WP_023308908.1 | short chain dehydrogenase | - |
| PUP35_RS16945 | 3596361..3597740 | - | 1380 | WP_274240650.1 | amidohydrolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11654.27 Da Isoelectric Point: 9.6244
>T272336 WP_111965881.1 NZ_CP117838:3592173-3592472 [Enterobacter sp. S-33]
MISYFRDQWLEDFFLYGRSSNVIPSNLETALARKLDIIRAATSHRDLRSPPGNMYEALNPPLKGYSSIRVNRQYRLVFCW
TEGKAEDLYLSPHKYTQHK
MISYFRDQWLEDFFLYGRSSNVIPSNLETALARKLDIIRAATSHRDLRSPPGNMYEALNPPLKGYSSIRVNRQYRLVFCW
TEGKAEDLYLSPHKYTQHK
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|