Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mqsRA (relBE)/MqsR-MqsA
Location 352912..353618 Replicon chromosome
Accession NZ_CP117821
Organism Xylella fastidiosa strain ICMP 8731

Toxin (Protein)


Gene name mqsR Uniprot ID Q87EE2
Locus tag PT013_RS01460 Protein ID WP_004090696.1
Coordinates 352912..353214 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name mqsA Uniprot ID Q87EE1
Locus tag PT013_RS01465 Protein ID WP_004090697.1
Coordinates 353217..353618 (+) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PT013_RS01425 (PT013_01425) 348680..349369 - 690 WP_012382453.1 contractile injection system protein, VgrG/Pvc8 family -
PT013_RS01430 (PT013_01430) 349299..350270 - 972 WP_011097609.1 hypothetical protein -
PT013_RS01435 (PT013_01435) 350278..350835 - 558 WP_011097610.1 phage tail protein I -
PT013_RS01440 (PT013_01440) 350828..351721 - 894 WP_011097611.1 baseplate J/gp47 family protein -
PT013_RS01445 (PT013_01445) 351721..352083 - 363 WP_014607615.1 GPW/gp25 family protein -
PT013_RS01450 (PT013_01450) 352257..352538 + 282 WP_004090695.1 type II toxin-antitoxin system RelE/ParE family toxin -
PT013_RS01455 (PT013_01455) 352549..352824 + 276 WP_004085172.1 HigA family addiction module antitoxin -
PT013_RS01460 (PT013_01460) 352912..353214 + 303 WP_004090696.1 type II toxin-antitoxin system MqsR family toxin Toxin
PT013_RS01465 (PT013_01465) 353217..353618 + 402 WP_004090697.1 type II toxin-antitoxin system MqsA family antitoxin Antitoxin
PT013_RS01470 (PT013_01470) 353687..354274 - 588 WP_011097612.1 phage baseplate assembly protein V -
PT013_RS01475 (PT013_01475) 354271..354813 - 543 WP_011097613.1 hypothetical protein -
PT013_RS01480 (PT013_01480) 354789..355310 - 522 WP_011097614.1 hypothetical protein -
PT013_RS01485 (PT013_01485) 355307..355630 - 324 WP_011097935.1 hypothetical protein -
PT013_RS01490 (PT013_01490) 355630..355890 - 261 WP_011097616.1 hypothetical protein -
PT013_RS01495 (PT013_01495) 355908..357782 - 1875 WP_011097617.1 phage major capsid protein -
PT013_RS01500 (PT013_01500) 357779..358411 - 633 WP_011097618.1 phage portal protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 345488..364769 19281


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin MqsR

(2-99)

Antitoxin

Cro/C1-type helix-turn-helix domain

(74-127)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 10948.71 Da        Isoelectric Point: 8.0251

>T272305 WP_004090696.1 NZ_CP117821:352912-353214 [Xylella fastidiosa]
MEKGTSHYKLPVVKALVKAGKVRATATAYQGARELGIKDLTGMCTVVLALTSADFYKSMTTYADHTVFQDVYHAKTASGD
EVYLKLTVIDDVLIVSFKEL

Download         Length: 303 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14944.02 Da        Isoelectric Point: 7.1650

>AT272305 WP_004090697.1 NZ_CP117821:353217-353618 [Xylella fastidiosa]
MRCPCCGAAELIHDTRDMLYTYKSETTSIPTVTGDFCPACGEVVLDREHGDRYSELVGLFQRQVNSAYVDPGYITKVRRK
LDLDQRQAAELFGGGVNAFSRYENGKTKPPLSLVKLFKLLDRHPDLLNEVKSS

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q87EE2

Antitoxin

Source ID Structure
AlphaFold DB Q87EE1

References