Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 3447444..3448259 | Replicon | chromosome |
Accession | NZ_CP117798 | ||
Organism | Proteus mirabilis strain IVRI/FBI/326 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | - |
Locus tag | PT008_RS16460 | Protein ID | WP_075673429.1 |
Coordinates | 3447786..3448259 (+) | Length | 158 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | - |
Locus tag | PT008_RS16455 | Protein ID | WP_075673430.1 |
Coordinates | 3447444..3447779 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT008_RS16435 (PT008_16435) | 3443133..3444557 | + | 1425 | WP_072069056.1 | aspartate ammonia-lyase | - |
PT008_RS16440 (PT008_16440) | 3444716..3446041 | + | 1326 | WP_109394971.1 | anaerobic C4-dicarboxylate transporter | - |
PT008_RS16445 (PT008_16445) | 3446225..3446797 | + | 573 | WP_098941859.1 | transcriptional regulator | - |
PT008_RS16455 (PT008_16455) | 3447444..3447779 | + | 336 | WP_075673430.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
PT008_RS16460 (PT008_16460) | 3447786..3448259 | + | 474 | WP_075673429.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
PT008_RS16465 (PT008_16465) | 3448570..3449217 | + | 648 | WP_109850424.1 | type II CAAX endopeptidase family protein | - |
PT008_RS16470 (PT008_16470) | 3449520..3450155 | + | 636 | WP_109850423.1 | DUF1449 family protein | - |
PT008_RS16475 (PT008_16475) | 3450241..3452436 | + | 2196 | WP_109850422.1 | flotillin family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 158 a.a. Molecular weight: 18639.26 Da Isoelectric Point: 9.2715
>T272276 WP_075673429.1 NZ_CP117798:3447786-3448259 [Proteus mirabilis]
MDFPTDLNGWTIYAHPCFKQQYDELLQKVEALKKKYPEDYQKKADTKIFAHVLKSIVNITNDPRAPEFRLGNTLGEENKN
WSRIKLVNGRYRLFFRFSFKEKIIILAWINDNDTLRTYGNKTDAYRVFEKKLKKGHPPKNWNDLFSDCINEADCQDP
MDFPTDLNGWTIYAHPCFKQQYDELLQKVEALKKKYPEDYQKKADTKIFAHVLKSIVNITNDPRAPEFRLGNTLGEENKN
WSRIKLVNGRYRLFFRFSFKEKIIILAWINDNDTLRTYGNKTDAYRVFEKKLKKGHPPKNWNDLFSDCINEADCQDP
Download Length: 474 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|