Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1780592..1781197 | Replicon | chromosome |
| Accession | NZ_CP117781 | ||
| Organism | Burkholderia sp. FERM BP-3421 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | - |
| Locus tag | Bsp3421_RS10875 | Protein ID | WP_273995957.1 |
| Coordinates | 1780919..1781197 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | Bsp3421_RS10870 | Protein ID | WP_273995955.1 |
| Coordinates | 1780592..1780897 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Bsp3421_RS10855 (Bsp3421_002176) | 1776662..1777747 | - | 1086 | WP_273995952.1 | ionic transporter y4hA | - |
| Bsp3421_RS10860 (Bsp3421_002177) | 1777999..1779588 | + | 1590 | WP_273995953.1 | 3-hydroxyacyl-CoA dehydrogenase PaaH | - |
| Bsp3421_RS10865 (Bsp3421_002178) | 1779662..1780465 | + | 804 | WP_273995954.1 | enoyl-CoA hydratase-related protein | - |
| Bsp3421_RS10870 (Bsp3421_002179) | 1780592..1780897 | - | 306 | WP_273995955.1 | HigA family addiction module antitoxin | Antitoxin |
| Bsp3421_RS10875 (Bsp3421_002180) | 1780919..1781197 | - | 279 | WP_273995957.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| Bsp3421_RS10880 (Bsp3421_002181) | 1781450..1782118 | + | 669 | WP_273995959.1 | MarC family protein | - |
| Bsp3421_RS10885 (Bsp3421_002182) | 1782134..1783000 | - | 867 | WP_273995960.1 | CPBP family glutamic-type intramembrane protease | - |
| Bsp3421_RS10890 (Bsp3421_002183) | 1783096..1783884 | - | 789 | WP_273995962.1 | DUF3050 domain-containing protein | - |
| Bsp3421_RS10895 (Bsp3421_002184) | 1784354..1785055 | - | 702 | WP_273995964.1 | fumarylacetoacetate hydrolase family protein | - |
| Bsp3421_RS10900 (Bsp3421_002185) | 1785183..1786103 | - | 921 | WP_273995966.1 | AraC family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10514.18 Da Isoelectric Point: 8.9187
>T272266 WP_273995957.1 NZ_CP117781:c1781197-1780919 [Burkholderia sp. FERM BP-3421]
MIQSFRCRNTAALFAGAPPPAFRAFERVACRKLAMLDAAHALRDLAAPPGNMLEALSGDRRHQYCIRINQRWRLCFEWTE
KGPAQVEIVDYH
MIQSFRCRNTAALFAGAPPPAFRAFERVACRKLAMLDAAHALRDLAAPPGNMLEALSGDRRHQYCIRINQRWRLCFEWTE
KGPAQVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|