Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 1388723..1388944 | Replicon | chromosome |
Accession | NC_017628 | ||
Organism | Escherichia coli IHE3034 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1PGT3 |
Locus tag | ECOK1_RS07120 | Protein ID | WP_000170954.1 |
Coordinates | 1388723..1388830 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 1388883..1388944 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECOK1_RS07095 | 1384568..1385650 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
ECOK1_RS07100 | 1385650..1386483 | + | 834 | WP_000456474.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
ECOK1_RS07105 | 1386480..1386872 | + | 393 | WP_000200375.1 | invasion regulator SirB2 | - |
ECOK1_RS07110 | 1386876..1387685 | + | 810 | WP_001257054.1 | invasion regulator SirB1 | - |
ECOK1_RS07115 | 1387721..1388575 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
ECOK1_RS07120 | 1388723..1388830 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 1388883..1388944 | + | 62 | NuclAT_12 | - | Antitoxin |
- | 1388883..1388944 | + | 62 | NuclAT_12 | - | Antitoxin |
- | 1388883..1388944 | + | 62 | NuclAT_12 | - | Antitoxin |
- | 1388883..1388944 | + | 62 | NuclAT_12 | - | Antitoxin |
- | 1388883..1388944 | + | 62 | NuclAT_13 | - | Antitoxin |
- | 1388883..1388944 | + | 62 | NuclAT_13 | - | Antitoxin |
- | 1388883..1388944 | + | 62 | NuclAT_13 | - | Antitoxin |
- | 1388883..1388944 | + | 62 | NuclAT_13 | - | Antitoxin |
- | 1388883..1388944 | + | 62 | NuclAT_14 | - | Antitoxin |
- | 1388883..1388944 | + | 62 | NuclAT_14 | - | Antitoxin |
- | 1388883..1388944 | + | 62 | NuclAT_14 | - | Antitoxin |
- | 1388883..1388944 | + | 62 | NuclAT_14 | - | Antitoxin |
- | 1388883..1388944 | + | 62 | NuclAT_15 | - | Antitoxin |
- | 1388883..1388944 | + | 62 | NuclAT_15 | - | Antitoxin |
- | 1388883..1388944 | + | 62 | NuclAT_15 | - | Antitoxin |
- | 1388883..1388944 | + | 62 | NuclAT_15 | - | Antitoxin |
- | 1388883..1388944 | + | 62 | NuclAT_16 | - | Antitoxin |
- | 1388883..1388944 | + | 62 | NuclAT_16 | - | Antitoxin |
- | 1388883..1388944 | + | 62 | NuclAT_16 | - | Antitoxin |
- | 1388883..1388944 | + | 62 | NuclAT_16 | - | Antitoxin |
- | 1388883..1388944 | + | 62 | NuclAT_17 | - | Antitoxin |
- | 1388883..1388944 | + | 62 | NuclAT_17 | - | Antitoxin |
- | 1388883..1388944 | + | 62 | NuclAT_17 | - | Antitoxin |
- | 1388883..1388944 | + | 62 | NuclAT_17 | - | Antitoxin |
- | 1388883..1388945 | + | 63 | NuclAT_10 | - | - |
- | 1388883..1388945 | + | 63 | NuclAT_10 | - | - |
- | 1388883..1388945 | + | 63 | NuclAT_10 | - | - |
- | 1388883..1388945 | + | 63 | NuclAT_10 | - | - |
- | 1388883..1388945 | + | 63 | NuclAT_11 | - | - |
- | 1388883..1388945 | + | 63 | NuclAT_11 | - | - |
- | 1388883..1388945 | + | 63 | NuclAT_11 | - | - |
- | 1388883..1388945 | + | 63 | NuclAT_11 | - | - |
- | 1388883..1388945 | + | 63 | NuclAT_6 | - | - |
- | 1388883..1388945 | + | 63 | NuclAT_6 | - | - |
- | 1388883..1388945 | + | 63 | NuclAT_6 | - | - |
- | 1388883..1388945 | + | 63 | NuclAT_6 | - | - |
- | 1388883..1388945 | + | 63 | NuclAT_7 | - | - |
- | 1388883..1388945 | + | 63 | NuclAT_7 | - | - |
- | 1388883..1388945 | + | 63 | NuclAT_7 | - | - |
- | 1388883..1388945 | + | 63 | NuclAT_7 | - | - |
- | 1388883..1388945 | + | 63 | NuclAT_8 | - | - |
- | 1388883..1388945 | + | 63 | NuclAT_8 | - | - |
- | 1388883..1388945 | + | 63 | NuclAT_8 | - | - |
- | 1388883..1388945 | + | 63 | NuclAT_8 | - | - |
- | 1388883..1388945 | + | 63 | NuclAT_9 | - | - |
- | 1388883..1388945 | + | 63 | NuclAT_9 | - | - |
- | 1388883..1388945 | + | 63 | NuclAT_9 | - | - |
- | 1388883..1388945 | + | 63 | NuclAT_9 | - | - |
- | 1388883..1388946 | + | 64 | NuclAT_18 | - | - |
- | 1388883..1388946 | + | 64 | NuclAT_18 | - | - |
- | 1388883..1388946 | + | 64 | NuclAT_18 | - | - |
- | 1388883..1388946 | + | 64 | NuclAT_18 | - | - |
- | 1388883..1388946 | + | 64 | NuclAT_19 | - | - |
- | 1388883..1388946 | + | 64 | NuclAT_19 | - | - |
- | 1388883..1388946 | + | 64 | NuclAT_19 | - | - |
- | 1388883..1388946 | + | 64 | NuclAT_19 | - | - |
- | 1388883..1388946 | + | 64 | NuclAT_20 | - | - |
- | 1388883..1388946 | + | 64 | NuclAT_20 | - | - |
- | 1388883..1388946 | + | 64 | NuclAT_20 | - | - |
- | 1388883..1388946 | + | 64 | NuclAT_20 | - | - |
- | 1388883..1388946 | + | 64 | NuclAT_21 | - | - |
- | 1388883..1388946 | + | 64 | NuclAT_21 | - | - |
- | 1388883..1388946 | + | 64 | NuclAT_21 | - | - |
- | 1388883..1388946 | + | 64 | NuclAT_21 | - | - |
- | 1388883..1388946 | + | 64 | NuclAT_22 | - | - |
- | 1388883..1388946 | + | 64 | NuclAT_22 | - | - |
- | 1388883..1388946 | + | 64 | NuclAT_22 | - | - |
- | 1388883..1388946 | + | 64 | NuclAT_22 | - | - |
- | 1388883..1388946 | + | 64 | NuclAT_23 | - | - |
- | 1388883..1388946 | + | 64 | NuclAT_23 | - | - |
- | 1388883..1388946 | + | 64 | NuclAT_23 | - | - |
- | 1388883..1388946 | + | 64 | NuclAT_23 | - | - |
ECOK1_RS07125 | 1389236..1390336 | - | 1101 | WP_001313768.1 | sodium-potassium/proton antiporter ChaA | - |
ECOK1_RS07130 | 1390606..1390836 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
ECOK1_RS07135 | 1390994..1391689 | + | 696 | WP_000632706.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
ECOK1_RS07140 | 1391733..1392086 | - | 354 | WP_001169659.1 | DsrE/F sulfur relay family protein YchN | - |
ECOK1_RS07145 | 1392271..1393665 | + | 1395 | WP_000086194.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.80 Da Isoelectric Point: 11.4779
>T27225 WP_000170954.1 NC_017628:c1388830-1388723 [Escherichia coli IHE3034]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T27225 NC_017628:c1388830-1388723 [Escherichia coli IHE3034]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 62 bp
>AT27225 NC_017628:1388883-1388944 [Escherichia coli IHE3034]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|