Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4117034..4117764 | Replicon | chromosome |
Accession | NZ_CP117750 | ||
Organism | Enterobacter hormaechei strain 2022CK-00700 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A837FIL2 |
Locus tag | PTC84_RS19925 | Protein ID | WP_023302825.1 |
Coordinates | 4117034..4117348 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PTC84_RS19930 | Protein ID | WP_032620773.1 |
Coordinates | 4117348..4117764 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTC84_RS19905 (PTC84_19905) | 4112700..4113785 | + | 1086 | Protein_3890 | cellulase family glycosylhydrolase | - |
PTC84_RS19910 (PTC84_19910) | 4113691..4114875 | - | 1185 | WP_015570118.1 | multidrug efflux MFS transporter EmrD | - |
PTC84_RS19915 (PTC84_19915) | 4115051..4115884 | - | 834 | WP_273961602.1 | DMT family transporter | - |
PTC84_RS19920 (PTC84_19920) | 4115947..4116393 | - | 447 | WP_003861064.1 | GNAT family N-acetyltransferase | - |
PTC84_RS19925 (PTC84_19925) | 4117034..4117348 | + | 315 | WP_023302825.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
PTC84_RS19930 (PTC84_19930) | 4117348..4117764 | + | 417 | WP_032620773.1 | helix-turn-helix domain-containing protein | Antitoxin |
PTC84_RS19935 (PTC84_19935) | 4117911..4118009 | + | 99 | WP_057979964.1 | ilvB operon leader peptide IvbL | - |
PTC84_RS19940 (PTC84_19940) | 4118116..4119804 | + | 1689 | WP_023302827.1 | acetolactate synthase large subunit | - |
PTC84_RS19945 (PTC84_19945) | 4119808..4120095 | + | 288 | WP_015570113.1 | acetolactate synthase small subunit | - |
PTC84_RS19950 (PTC84_19950) | 4120221..4120814 | + | 594 | WP_003861054.1 | transcriptional regulator UhpA | - |
PTC84_RS19955 (PTC84_19955) | 4120811..4122316 | + | 1506 | WP_180242744.1 | signal transduction histidine-protein kinase/phosphatase UhpB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12415.51 Da Isoelectric Point: 10.2825
>T272249 WP_023302825.1 NZ_CP117750:4117034-4117348 [Enterobacter hormaechei]
MHLISMKAILDAVSQFPQHREELLFLGRVIEKSHCPTPAALRKLFPTLDNFKYLDKHYVIDIANNNLRVVALIFFESQKF
YVRHVFTHKEYDRFTEKHRTKGKK
MHLISMKAILDAVSQFPQHREELLFLGRVIEKSHCPTPAALRKLFPTLDNFKYLDKHYVIDIANNNLRVVALIFFESQKF
YVRHVFTHKEYDRFTEKHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15249.77 Da Isoelectric Point: 5.2068
>AT272249 WP_032620773.1 NZ_CP117750:4117348-4117764 [Enterobacter hormaechei]
MIVADAMKATHALVAAVPLLGEQPSEKDYKDALELVEYLLMNEPNSPLLDIVCARISHYEANGPEIVALRKEMESVPVGI
AVLRTLMDQYNLTISDFKDEIGSKSMVSRVLNGQRQLTLNHIKKLAARFGVSPALFIE
MIVADAMKATHALVAAVPLLGEQPSEKDYKDALELVEYLLMNEPNSPLLDIVCARISHYEANGPEIVALRKEMESVPVGI
AVLRTLMDQYNLTISDFKDEIGSKSMVSRVLNGQRQLTLNHIKKLAARFGVSPALFIE
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|